KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_182
Entry
AB162_182         CDS       T04544                                 

Gene name
mutS
Definition
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AB162_182 (mutS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_182 (mutS)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AB162_182 (mutS)
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_II MutS_IV DUF496 AAA_27
Other DBs
NCBI-ProteinID: AKZ65787
UniProt: A0A0K2BKR9
LinkDB
Position
194852..197434
AA seq 860 aa
MKTLLENTIINHTPMMQQYFKLKAKHKDILLFYRMGDFYELFYDDAKRVSQLINISLTKR
GSSAGEPIPMAGVPYHAVESYLAKLVALGESVAICEQIGDATTTTTNGLLERRVVRIITP
GTVIDEALLNEHQDNLLAAIWQESNSFGYATLDMTSGKFILSEHNNLYAMAAELQRTNPS
ELLYPDNLNNLVLIENRRGLRRRPIWTFELETACKQLMLQFGTSSLNGFGIEKTTLALRA
AGCLLQYAKDTQQCTYLPNISTVILEQQQDYVIIDAITMRNLELTKNFSGCADNTLINII
DNTVTSMGSRMLKRWLSRPTRNLKIITDRQESIKYLQNIVEYIQPVLRTIGDIERIIVRL
ALRSARPRDLVRMRHAFQQLPEIKLCFNKEQLLGEHIKKLISNIGSFDNLRLLLERAIVE
YPPIMVRDGGVIATGYSAELDKLRFLSDNATDYLDRLEIIERASTGLDTLTVGFNAVHGY
FIQISRRQSHLAPARYIRRQTLKHAERYIIPELKEYEDKVMTSKVKALSLEKTLYDEVID
LIFPHVAQLQQSAAALAELDVLTNLAERADTLNYVCPLISDKPGIDIIGGRHPVVEKYIS
EPFIDNSLSLSTKYNMLIITGPNMGGKSTYLRQNALIVLLSYIGSFVPASQATIGPIDRI
FTRIGAADDLASGRSTFMVEMTETANILNNATCHSLVLMDEIGRGTSTYDGLSLAWACAE
HLANTIQAMTLFATHYFEMSTLSEKINGIVNVHFDAKEYDNTIVFLHSLQKGTTSKSYGL
SVAVLAGIPNKVIHSARKKLSQLEIIYNKSDTNVHVVSQIEHNKCNNNLIEFVKNIDPDS
LSPLQALNVLYNIKKMLLLT
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgaaaacattattagaaaatactataattaaccatactcctatgatgcagcagtatttt
aagctaaaagctaagcataaggatattttactgttttaccgcatgggtgatttttatgaa
ttattttatgatgatgctaagcgggtatcacaattaatcaatatatctttaacaaaacgc
ggctcatcagctggtgaaccaattccaatggctggggtaccttatcatgcagtagaaagt
tatttagctaaattagtagcactgggcgaatctgtagcaatttgtgaacaaattggagat
gctaccacaactactactaatgggctgttagaacgtcgtgttgtacgtattattactcct
ggtactgttatcgatgaagcattactaaatgaacatcaggataatttacttgctgctata
tggcaggaatcaaatagttttggttatgcaactttggatatgacttcaggtaaatttatc
ctttcggaacacaacaatttatatgctatggctgcagaattacagcgtactaacccatct
gaactactgtatccagataatctaaataatttagtacttattgaaaaccgtcgtggtctg
cgacgtcggccaatatggacatttgaactagaaacagcttgtaagcaactgatgctacag
tttggaactagtagtttaaatggttttggtattgaaaagacgactttggcgctacgtgca
gctggttgcctactgcaatatgcaaaagatacacagcagtgtacttatttacccaatatt
agtactgttatattagaacagcaacaagactacgttattattgatgctattacaatgcga
aaccttgagctaacaaagaattttagtggctgcgcagacaacacgctcattaatattata
gataatactgtaacttcaatgggcagtagaatgctaaaacgttggctatctagaccaact
agaaatcttaaaataataacagatcgtcaagaaagtataaaatatttacaaaatatagtt
gaatatatacaaccagtgctacgcactataggcgatatagagcgaataatagtgcgttta
gcactaagatctgcacgtcctcgtgatctagtacgtatgcgtcatgctttccagcaatta
ccagaaattaaactatgtttcaataaagaacagctgcttggtgaacatattaaaaaatta
attagtaatatcggtagtttcgataatctgcgactattattagagcgtgctattgttgaa
tacccaccaataatggtgcgtgatggcggtgttattgcaaccggatacagcgcagaatta
gataaattacgttttttatctgataatgctacagactatttagatagactggaaattata
gagcgtgctagtaccggactagatacactaacagttggctttaatgctgtacatggctat
ttcattcagataagccgtagacagagtcatctagccccagcacgctatatccgtaggcaa
actcttaaacatgcagaacgttatattattcctgagctgaaagagtatgaagataaagtg
atgacatcaaaagttaaagcattatcactagaaaaaactttgtatgatgaggtaattgat
ttaatatttccgcatgtagctcaattacagcagagcgcagctgctttagctgaacttgat
gttttaacaaacttagcagaacgtgctgatacactaaattatgtatgtcctttaatcagt
gataaacctggtatcgatattatcggtggtcgacaccctgtagtagagaagtatataagc
gagccatttatagataattctttatcattatcaactaaatataatatgcttattatcact
ggacctaacatgggtggtaaaagtacttatttgcgccagaatgcactgattgttttatta
tcctatattggtagctttgtacctgcttcgcaggctacaataggacctattgatcgtatt
tttactcgtataggcgcagcagatgatctagcttcgggtcgttcgacatttatggtagaa
atgactgaaacagcaaatattctaaataacgcgacttgccatagtttagtattaatggat
gagattggtcgtgggacatctacatatgatggtttatcactggcttgggcctgtgcagaa
caccttgctaacaccattcaagcaatgactttgtttgctacgcattattttgagatgtct
actctatctgaaaaaataaatggtattgtaaatgtacatttcgacgcaaaagagtatgat
aatacaatagtatttttgcatagtttacagaaaggtactactagtaaaagctatggttta
tcagtcgctgttttagctgggataccaaataaagtgatacacagtgcaagaaaaaagtta
tctcaattagaaattatttataataagtctgatactaatgttcatgtagtatctcagatt
gaacataataaatgtaataataacttaattgagtttgttaaaaacatagatccagacagc
ttatctccacttcaagcacttaatgtattatacaatattaaaaaaatgctattattaaca
taa

DBGET integrated database retrieval system