KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_257
Entry
AB162_257         CDS       T04544                                 

Gene name
ruvB
Definition
(GenBank) Holliday junction DNA helicase
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_257 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_257 (ruvB)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AB162_257 (ruvB)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB162_257 (ruvB)
    RecFOR pathway proteins
     AB162_257 (ruvB)
SSDB
Motif
Pfam: RuvB_N RuvB_C AAA_lid_4 AAA AAA_5 Mg_chelatase AAA_22 Sigma54_activat AAA_14 AAA_3 RNA_helicase AAA_18 IstB_IS21 TIP49 NTPase_1 AAA_16 DUF815 TsaE Rad17 MCM ABC_tran NB-ARC AAA_24 Bac_DnaA AAA_17 HTH_15 AAA_19 AAA_25 AAA_PrkA AAA_33
Other DBs
NCBI-ProteinID: AKZ65858
UniProt: A0A0K2BLC6
LinkDB
Position
complement(282714..283724)
AA seq 336 aa
MIESDDSLISKEEVVDYHYRPKKLVDYIGQPSISEQMKIFIQAAKIRGEALDHILLFGPP
GLGKTTLATIIANEMEVHLRSTSGPILEKAGDLAAILTNLESHDVLFIDEIHRLPHVVEE
ILYPAMEDYQLDIMIGEGPAARSIKIKLPKFTLVGATTRAGSLTSPLRDRFGIVQRLEFY
SNKDLQKIIQLSATYLSLTITDGGAIEIARRARGTPRIANRLLRRVRDFAEVNNNAASSS
DGNNKITIDVAMRALNMLNVDTAGLDYMDRKLLLVIINKFFGGPVGLDNLAAAIGEEKET
IEDVLEPFLIQQGFIQRTPRGRIVTDEAYRHFSLQR
NT seq 1011 nt   +upstreamnt  +downstreamnt
ttgatagaatctgatgatagtttaatttctaaagaagaagtagtcgattaccactatagg
ccaaaaaaattagtggattatattggccaacctagtataagtgagcaaatgaaaattttt
attcaagctgcaaaaatacgcggagaggcattagaccatatattactttttggtccacct
ggattaggtaaaactacgttagcaactattattgctaacgaaatggaggtacacctgcgt
agtacatctggtcctattttagaaaaagcaggagatttagccgcaatactaaccaactta
gaatcgcatgacgtattatttatagacgaaattcatcgtttaccacatgtagttgaagaa
atattatatcctgcaatggaagattatcagctagatataatgataggtgagggaccagca
gcacgttcaattaaaataaaattaccaaaatttacgttagttggtgcaactactagagca
ggatctttaacttcaccattacgtgatcgttttggtattgtccaaagattagaattttat
tctaataaagacttacaaaaaattatacaacttagtgctacttacctatcgttgactatc
actgatggtggagcaattgaaattgcgcgacgtgcaagaggtactccacgtatcgctaat
aggcttctaagaagagtaagagacttcgcagaagtaaataataatgctgctagtagtagt
gatggtaataataaaattactatagatgtagcaatgagagcactaaatatgcttaatgtt
gatactgctggattggattatatggatcgtaaattactactcgtaattattaataaattt
tttggaggaccagtaggattagataatctagcagcagctattggtgaagaaaaagagact
atagaagatgtactagaaccatttttaatccaacaagggtttatccaacgaacacctaga
ggacgtattgttactgatgaagcttatcgtcactttagtttacaaaggtaa

DBGET integrated database retrieval system