KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_259
Entry
AB162_259         CDS       T04544                                 

Gene name
ruvC
Definition
(GenBank) Crossover junction endodeoxyribonuclease
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_259 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_259 (ruvC)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     AB162_259 (ruvC)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB162_259 (ruvC)
    RecFOR pathway proteins
     AB162_259 (ruvC)
SSDB
Motif
Pfam: RuvC NeuB
Other DBs
NCBI-ProteinID: AKZ65860
UniProt: A0A0K2BKK0
LinkDB
Position
complement(284436..284924)
AA seq 162 aa
MTIIIGIDPGSRMTGYGVICQKEQSISYVASGCIRTKVNDFPNRLKLIYIGVNQIITQFK
PQYFAIEQIFIAKNFNSALKLSQASSVAIVAAMNNNIPVFEYAARQVKQTLVGIGSAEKN
QVQHMVRTLLNLSTTPKVDAADALAIAITHCHVSKNAIHEYL
NT seq 489 nt   +upstreamnt  +downstreamnt
atgactattattataggtattgaccctggttcacgcatgactggttatggtgttatatgt
caaaaagaacaaagtattagctatgtagctagtggttgtattagaaccaaagtcaatgat
ttccctaaccgattaaaattaatttatattggtgtaaaccagattattactcaatttaag
ccgcaatactttgctattgagcagatttttatagctaaaaattttaattcggcgctgaag
cttagtcaagcaagtagtgtggctatagtagcagctatgaataataatattccagtattt
gaatatgctgcccggcaagtaaaacagacattagtaggtattggttcagctgaaaaaaat
caggtacagcatatggtacgtaccttacttaatttatcaactactccgaaagttgatgca
gcagatgcattagcaatagctataacacattgccatgttagtaaaaatgctattcacgaa
tacttataa

DBGET integrated database retrieval system