KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_487
Entry
AB162_487         CDS       T04544                                 

Gene name
dnaE
Definition
(GenBank) DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_487 (dnaE)
   03430 Mismatch repair
    AB162_487 (dnaE)
   03440 Homologous recombination
    AB162_487 (dnaE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_487 (dnaE)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_487 (dnaE)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_487 (dnaE)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_487 (dnaE)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_487 (dnaE)
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon tRNA_anti_2
Other DBs
NCBI-ProteinID: AKZ66070
UniProt: A0A0K2BL77
LinkDB
Position
505697..509188
AA seq 1163 aa
MTQPRFIHLRIHSDYSIIDGLIKVSTLVETAASMNMPALALTDCTNFFGIIKFYKSAYSV
GIKPIIGADLLIKSNTLGDELTELTILTTNNLGYHNLIMLISKAYKRGYGTDGPFIDRDW
LIKYNEGLIIISGARKGDLEQTLMRGQKIKFKQCLAFYQRYFKDRYYLGLIRTGRPEEEQ
YIKSSVELSNYYGLPVVANNDVRFIHNDDYHAHAIKVAIHEGSDLFSSKRKNNYSSQQYL
RSEQDMCELFADIPESLANSVEIARKCNVTIRLDEYFLPTFPISSNISIEDYLIKSATKG
LEDRLNFSFPDAMQRSNKKLYYNERLNKELKVINKMGFAGYFLIVMEFIKWSKDNNIPVG
PGRGSGSGSLVAYALNITDIDPLVFDLIFERFLNPERVSMPDFDIDFCMEKRDMVIDHVA
QTYGRDAVSQIITFGTMAAKAVIRDVGRVLGYPYPFINSLAKLVPNDIGIKLEQALILEP
ELQKLYILNEDVKVLIDIAKKLEGMTRNVGKHAGGVVISPTKITDFSPLYCDEQGNYPVT
QFDKNDVENAGLVKFDFLGLRTLTIINRTLKIINTRYVLNNINPINIQTIPLDDKKSFKM
LQSANTTAVFQLESKGMKELIKRLQPDCFEDIIALVALFRPGPLKSGMVDNFINRKHGRE
AICYPDINWQHKSLKPVLEPTYGIILYQEQVMQIARILAGYTLGEADILRRAMGKKNYAV
MVKQRAKFKAGAELLGINGELSMKIFNLLEKFAGYGFNKSHSAAYALVSYQTMWLKVHYP
AEFMAAAMTADIDNHEKIIIIINECLRMGIVVLPPDINKGQYHFHVNENREIIYGMGAIK
CLGKAQISSIIEERNKNGKFVDLFNLCKRIDIKKLNRRMLEKLILSGACDKLGPHRAAIM
KLLDLALKTADQSANSDSRGQIDIFGVNNIKNQVFFDQYLGPNFRPWSETVMLNGERETL
GIYLTGNPITQYLNEIKYYTGGVSLKDIHCLERGKQVTVVGLILSLKIKVTKQGNKICIC
TINYLNEHLDVIIFTPILQKYKNFLQKDTIVLVAGEVSVDNVTGSCQLIAINIMDINTAR
KKFSCGLAISLTKQQINKDFLKNISLTIKPHLSGIIPVHIYSKIENVRIRMRFGTNWQVM
PTDDLLNDLRLLVGHEQVQLEFD
NT seq 3492 nt   +upstreamnt  +downstreamnt
atgactcaaccacgttttattcacttacgtatacatagcgactattccattattgatgga
ttaataaaagttagtactttagtggaaacagcagcatctatgaatatgccagcattagct
ttaacagattgtactaatttttttggtatcattaaattttataaatcagcatatagtgta
ggaattaagccaattataggtgctgatttgttgataaaaagtaatacactaggtgatgaa
ctcactgaattaacaattctaactactaataacttaggctatcataatttaataatgctt
atctccaaagcatataagagaggctatggtacagatggcccttttatagatcgagattgg
cttataaaatataatgaaggtttaattattatttctggagcacgtaaaggtgatcttgaa
caaaccttaatgcgtggtcaaaaaattaaatttaaacagtgcttagctttctaccagcgc
tattttaaagatagatattatctaggacttattaggactggtagaccagaggaagaacaa
tatattaaatcttctgtagaactatctaattactatggattaccggtagtagcaaataat
gacgtacgttttattcataatgatgattatcatgcacatgccattaaagttgctatccat
gaaggctctgatttattttcttctaaaagaaaaaataactatagttcacaacagtatctt
cgaagcgaacaggatatgtgcgaattatttgcagatattccagaatcattagctaatagc
gtagaaatagctcgtaaatgtaatgtaactattagacttgatgaatattttttaccaaca
tttcctattagtagcaatatttctattgaggattatttaattaaatctgcaacaaaaggg
ttagaagatagactaaattttagttttccagatgctatgcagcgcagcaataagaaatta
tattataatgaacgtttaaataaagagctaaaagtaattaacaaaatgggatttgcaggc
tattttcttatagttatggaatttatcaaatggtctaaagacaataatatacctgtagga
ccaggcagaggatcaggatctggttctctagtagcctatgcacttaatataactgatatt
gatccgctagtttttgatctcatatttgagagatttctaaatcctgaacgtgtttctatg
ccagactttgatattgatttttgtatggaaaaaagagatatggtcattgaccatgtagca
caaacttacggtcgtgatgctgtatcacagattattacttttggtactatggctgcaaag
gctgtaatacgtgatgttggtagggtattaggttacccttatccatttattaatagttta
gctaaactagtacctaatgatattggaattaagctagaacaagctttaatactagaacct
gagctacagaagctatatatacttaatgaagatgtaaaggtattaatagatattgcgaaa
aaactagaaggtatgactcgtaatgtaggtaaacatgcaggtggagtagtaatttcgcca
actaaaattactgatttttctccgttatactgtgacgaacaaggtaattatccagttact
caattcgataagaatgatgtagaaaatgctggtttagtgaaatttgattttctaggatta
cgtactctaactatcataaacagaactttaaaaataataaatactaggtacgtgcttaat
aatatcaatcctattaatattcaaactattccattagatgataaaaaaagcttcaagatg
ttgcaaagtgcaaatactacggccgtatttcaactagaatcaaaaggaatgaaagaactt
attaaacgcctacaacccgactgtttcgaagatattatagcattagtagcattgtttcgt
cctggcccgctgaagtctggtatggtagataattttataaatcggaaacacgggcgtgaa
gctatttgttatccagatataaattggcaacacaaatctttaaagccggtattagaacct
acctatggcattattctttatcaggaacaagttatgcagatagctagaatactagcaggg
tatacacttggtgaagctgacatactacgacgcgctatgggaaaaaaaaattatgcagta
atggttaagcagagagcaaaatttaaggcaggcgcagagcttttaggtattaacggtgag
ttatctatgaaaatatttaatttattagaaaagttcgcaggatacggttttaataaatct
cactctgctgcttatgctctagtttcctaccaaactatgtggctaaaagtacactatcca
gcagaatttatggctgctgctatgactgcagatatagataatcatgaaaaaattattatt
attataaatgaatgcttacgtatgggtattgtagtattaccacctgatattaataaaggt
cagtatcattttcatgttaatgaaaatagagaaataatttatgggatgggtgcaataaaa
tgtttaggtaaagcacaaatttcttcaattattgaagaacgtaataaaaatggaaaattt
gttgatttatttaatttatgcaaacgtatagatataaaaaaactaaaccgacgtatgcta
gaaaagctgatattgtctggcgcttgcgataaactaggaccgcatcgtgctgcaattatg
aaattattagatctagcattaaaaacagctgatcaatctgctaactcagatagcagaggt
cagatagatatctttggggtaaataatataaaaaatcaagtattttttgatcaatattta
ggtccaaattttagaccttggtcggaaacagttatgcttaatggtgagcgggaaacttta
ggaatatatttaacaggtaatcctattacacaatatttaaatgaaattaaatattatact
ggcggagttagtttaaaagacattcattgtctagaacgtggtaaacaggtaacagtagtt
ggtttgattttatcgttgaagataaaagtaactaagcaaggtaataagatttgcatatgt
actataaattatctaaatgaacatttagatgttattatttttaccccaatactacaaaaa
tacaaaaattttttacaaaaagatactattgtgctagtagctggtgaagttagcgttgat
aacgtgacaggaagctgtcagttaattgctataaacattatggatattaacacagcacgt
aaaaaattttcttgtggacttgctatatcgctaactaaacaacaaattaataaagacttt
ttgaaaaatattagtttaactattaaaccacatttatcaggaatcattcctgtgcatatt
tattctaaaatagaaaatgtacgtatacgtatgcgttttggtaccaattggcaggttatg
cctactgacgatttactaaatgatttacgtcttttggtaggtcatgaacaagttcaacta
gaatttgactaa

DBGET integrated database retrieval system