KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_489
Entry
AB162_489         CDS       T04544                                 

Gene name
mutH
Definition
(GenBank) DNA mismatch repair endonuclease
  KO
K03573  DNA mismatch repair protein MutH
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AB162_489 (mutH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_489 (mutH)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Strand discrimination factor
     AB162_489 (mutH)
SSDB
Motif
Pfam: MutH MvaI_BcnI
Other DBs
NCBI-ProteinID: AKZ66072
UniProt: A0A0K2BLL1
LinkDB
Position
511191..511880
AA seq 229 aa
MINFSTMSISQPANERELLLRAQSLAGFSLGELAGHANKIIPNNLNRSKGWIGKLIEMYL
GASAGNKPEPDFTAIGVELKTIPIDNYGRPLQTTFVCVAQLTGNSGITWEASYVRYKLTR
VLWIPVEGQREIPLSQRRIGNPILWSPDATELLQLKSDWEELMDLIVLGKVTSITASYGE
VLQLRPKAANNLAVTTAIDDLGKIINTIPLGFYLKKTFTSKLLSSNFFI
NT seq 690 nt   +upstreamnt  +downstreamnt
atgattaacttttctactatgtctatttcccagccagctaatgaaagagaattattatta
agagctcaatcgttagctggattttcacttggagaactagctggacatgcaaataaaata
atacctaataacctaaatagatctaaaggctggataggtaaattaatagaaatgtatctg
ggtgctagcgcaggtaataagccagagccagactttacagctattggtgttgagttaaaa
actattcctattgataattatggacgtccgttacaaactacttttgtatgcgtagcacag
cttacaggtaatagtggtattacatgggaagcaagctatgtacgctataagttaactaga
gttttgtggattccagtagaaggacagcgtgaaatacctttatcccaaaggcgtattggt
aatcctatattatggagcccagatgcaacagaattactacaattaaagtccgattgggag
gaacttatggacctaattgtattaggtaaggtaactagtattactgcaagctatggcgaa
gtactgcaactaagacccaaagctgctaataatctagctgtaacaacggctattgatgat
ttaggtaaaataattaatactataccgctaggcttttacctaaaaaaaacattcacaagt
aagttactatcgagtaatttttttatttaa

DBGET integrated database retrieval system