KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_493
Entry
AB162_493         CDS       T04544                                 

Gene name
recC
Definition
(GenBank) Exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_493 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_493 (recC)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AB162_493 (recC)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB162_493 (recC)
SSDB
Motif
Pfam: Exonuc_V_gamma RecC_C
Other DBs
NCBI-ProteinID: AKZ66076
UniProt: A0A0K2BL21
LinkDB
Position
514276..517611
AA seq 1111 aa
MIFMLTIYHSNKLDLLKNIAVRLISQCKLPDPLQQELILVNSYCMAQWIQMELACSFDIA
ANINFYLPANFIWKIYNCLLPDFNIEKLLSKSAMTWRIMKIMQRLYNTSDFNLIRESIKE
DIDKRKQFHFAISVADLFDQYLIFRPDWLEIWLHGKQLVNLGDHQRWQAKLWQALIEDIF
STKTKFLHFDNLYQSLLKTIQNSDARRRLIGLPERIFIFGLPSLPPLYMKIINLLGNYID
IHLMFINPYRNDRIKIDSNTCLKLNNQIEPNIGNPLLKSWGKLGRDTISIFSKLKNVHNV
EDFLEFSSGEECLLSVVQRDILEDYSLLNNKKRLLQPKDRSISIHVCHSPQREIEVLHDN
LLYMIAENKDISPREVIVMVADIDIYAPAINAVFGNATEERYLPFSIYDYRVKNFHPVLK
VFLSLLKLPFSRCTSEEILALLDIPALAARFSMSKKNINLLGQWIAESGIRWGLDDDMLS
DLMFPAATGQQHTWQFGLHRMLLGYAMDKNSGTWQDILPYNESSGLIAELIGKLAELLVV
LRRWRNYLIQSRPLNQWLTSASDIINDFFISTIDIETEAALTLVVNHWQQMLQFSLESNY
DEPVSIILLHDELTMRLAQEGISKSFFLGKINFCTMMPMRSIPFKIVCLLGMNDGVYPHT
TIFPVSFDLIAQHPRLGDSNRRDEDRYIFLEALLSAKYYFYISFIGTKIQDNSSCYPSVL
VSELTNYITQSFYLSGDEQLKEQTIVRNIRNYLWQLHSRMPFAPENFITDSENQSYSKEW
FLAAKAAANVANANNHYQKPQYAFISSLSSMQEEIIVLDDLKNFYKHTVRTFFQKRLAIW
LDQEQQYIIPDTEPFQITDLNNFNIKEKILNTLIEKNNIEIIYQQVRTAGMLSYGAFGKI
YWKKECNSMMKLAANIRLFILPKFFSQEVKLTIGKTDLIGWLPRVQNNGLLRWRPSAIYI
NDGLQLWIEHLAYCAIGGHGDSRLFGTNGYWHFSVLSEEEAKNYLLTLVNGYWQGMSEPL
LLLNRSGGAWLNHCFNRNTNNIDWNKQIQQEAKDKMIQSWKGDKFFYGEKRDPYLQLLIR
KLNKEHITAIIQAAESYFMPILKHNNIASYF
NT seq 3336 nt   +upstreamnt  +downstreamnt
ttgatttttatgttaactatttatcattctaataaactagacctattaaagaatattgct
gttagattaatttctcaatgtaagctacctgatccattacagcaagaattaatattagta
aatagctattgtatggcacagtggatacagatggaattagcttgttctttcgatattgca
gctaatattaatttttatttacctgccaattttatctggaaaatttataactgcttgtta
ccagattttaatatagagaaactattatctaagtcagcaatgacttggagaattatgaaa
ataatgcagcgtttgtacaatacatctgattttaatctcattagagagtctataaaagag
gatatagataagcgtaaacagtttcattttgctataagtgtagcagatttatttgaccaa
tatttgatttttcgcccagactggttagaaatatggctgcatggtaagcaactggttaat
ttaggtgatcatcaacgctggcaagctaagttatggcaagctttaatagaagatatattt
tctacaaaaacaaaatttttacattttgataatttatatcaaagtttacttaaaactatt
caaaatagtgacgcacgacgacgtcttataggattaccagaaagaatatttatttttggt
cttccttcgctaccaccgctatatatgaaaataataaatttattaggtaactatatagac
atacatttaatgtttattaatccatatcgtaacgataggataaaaatagacagtaataca
tgccttaaattaaacaaccaaatagaacctaatataggtaatcctctattaaaatcttgg
ggaaaattaggtagagatactatatctattttttctaagctaaaaaacgtgcataatgta
gaagattttttagaattctcctctggagaggaatgcctacttagtgtagtacaaagagat
atattagaagactatagtcttctaaataataaaaaaagattgctacagccaaaagataga
tctattagtatacatgtttgccatagcccccaacgtgaaatagaagtattgcacgataat
ctactttatatgatagcagaaaataaagatatttccccgcgagaagtaattgttatggtt
gctgatattgatatttatgctcctgctattaatgctgttttcggcaatgcaacagaagaa
cgttatttacctttttctatctatgattacagagtgaaaaattttcatcctgtattaaaa
gtatttctaagtttacttaaattaccatttagcagatgtacctctgaagaaattttagct
ctactagatattcctgctctagcagctcgtttctctatgagtaaaaaaaatattaattta
cttggtcaatggatagcagaatctggtattcgttgggggctagatgacgatatgttaagc
gatttaatgttcccagcagctactggtcagcagcatacttggcagtttggtttacatcgt
atgctattaggctatgcaatggataaaaatagtggaacgtggcaagacattttaccttat
aatgaatccagcggattaattgctgaattgataggtaagttagccgaactattagtagta
ttacgccgttggcgtaattacttgattcaatctcgtccgcttaatcaatggctaaccagc
gcaagcgatataattaatgatttttttatctctaccattgatatagagacagaagcagct
ttgacattagtagtaaatcattggcagcagatgctgcagtttagtttagaatcaaattat
gacgaaccagtatctattattttgttgcatgatgaattaactatgcgtctagctcaagag
gggataagtaaaagtttttttttaggaaaaattaacttttgtactatgatgccaatgcgt
tctattcctttcaaaatagtttgcctattaggcatgaacgatggtgtatatccgcatact
acaatatttccggttagttttgatttaatagcgcagcatccgcgactaggcgatagtaat
aggcgtgatgaagacagatatatatttcttgaagcactgttatcagctaaatattacttt
tatatcagttttattggcacaaaaatccaagataatagttcttgttatccatctgtacta
gttagtgaactgactaattatattacacaaagcttttatctttctggagacgaacaactg
aaagaacaaactatagttagaaatatacgtaattacttatggcaattgcatagtcgtatg
ccttttgcaccagaaaattttattactgatagcgaaaatcagagttactctaaggaatgg
tttttagctgctaaagcagctgctaacgtagctaatgctaataatcactaccaaaagccg
caatatgcttttattagttcactatctagtatgcaagaagagataatagtattagatgat
ttaaaaaatttttacaaacatacagtacgaactttttttcagaaaaggctagctatttgg
ttagatcaagagcagcaatatattattcctgacactgaaccttttcagatcacagatctt
aataattttaatattaaagaaaaaatattaaatacactgattgagaaaaacaatatagaa
attatataccaacaagtacgtactgcaggtatgctgtcttatggtgcttttggcaaaata
tactggaaaaaagaatgtaatagcatgatgaagctagcagctaatatcagattatttatc
ttacctaaattttttagccaggaagtaaaattaactattggtaaaactgacctgatagga
tggctaccaagagtacaaaataatggtctgcttcgctggcgtccaagtgcaatttatatt
aatgatggtttacaactatggatagagcatcttgcttattgcgcgattggtggacatggt
gatagccgattgtttggtacaaatggttattggcatttctcagtactgtcagaagaagaa
gcaaaaaattatttacttacgttagttaacggttattggcaaggaatgtcagagcccttg
ttgttgctgaatcgttcaggtggagcgtggttaaatcactgttttaacagaaatactaat
aatatagattggaataaacagattcaacaagaagctaaggataaaatgatccagtcttgg
aaaggagataaatttttttatggggaaaaaagagatccttatttgcaactactaatacgt
aaattaaataaagagcatataacggcaattattcaggctgcagagtcttattttatgcca
atattaaagcataataatatagcatcctatttttga

DBGET integrated database retrieval system