KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_495
Entry
AB162_495         CDS       T04544                                 

Gene name
recD
Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_495 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_495 (recD)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AB162_495 (recD)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB162_495 (recD)
SSDB
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 Helicase_RecD UvrD_C_2 AAA_11 DUF2075 UvrD-helicase SH3_13 AAA_22 AAA_24 DEAD PhoH FtsK_SpoIIIE TrwB_AAD_bind
Other DBs
NCBI-ProteinID: AKZ66078
UniProt: A0A0K2BM12
LinkDB
Position
521381..523294
AA seq 637 aa
MEEIIIQAQKLNLWRPLDIYFARMIAAASSPDYYSQALLLLASACLSADIGVGHVCLPLS
RLTKNYLFEGRYPKLSMQIFQKIGHPNMETWHNVLLKSPSVSDGLYSTPLVLDNNMLYLH
RLWQYECTIANFFNRPLMIINNQINYKLVSTVLDSIFSKNNHNHIMNWQKIAIAIAITSK
VALISGGPGTGKTNTLAKLLVALLLINTDSTNYSARLRIIITTPNSQMISRLREYIMLSM
NNLILDNSLRNKIVYQIMSIPRLLGVLPNSKRMRYNCDNKLNVDILIIDDASMIDLQMMA
NIINAIPNQTKVIFFGDYYQLASVETGAVFRDICKFADTSGYSEIRSQYLVSLTSCRKIF
YRSENNYRQNKIADIFCCLRTNYRFKDSSGISHLANAIKAGNIKDTIALLNSIKYPEINY
IPRSNKNDYKNMVDDFVTGYQYYLKLVHQGKSHHKILEYFNKYRILAVLREGQFGVNNLN
SSIEHALICYGLIKKTISFSCYVGQPIIIMRNSPLLELYNGDIGIVLLDSKHTRLLAYFP
LYDGTIKTVPINCLPKYETAFTITVHQSIGSEFTNTALVLPDNILPVLTRELLYTGVTRA
CKNLSIYAPHNKEVLVHTINSTINRRSGLKEKLLIIE
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggaagaaattataatccaggcacagaaactaaatttatggcgcccgttagatatttat
tttgctcgtatgatagcagcagcgtcatcgcctgattattattcacaggcattattacta
cttgctagtgcttgtcttagtgcggatataggagtaggccatgtgtgtctaccattatca
agattgaccaaaaattacctattcgaaggtcgctacccaaaactatctatgcaaattttt
caaaaaattggtcacccaaatatggaaacttggcataatgtgctactaaaatcaccatca
gtaagcgatggtttatactcaacgcctttagtactagataacaacatgctttatttacat
cgtctgtggcaatatgaatgtactattgctaatttttttaacagaccgcttatgattatt
aataatcagataaattataaactagttagcactgtattagacagtattttttcgaaaaat
aaccataatcatattatgaactggcagaaaattgctattgctatagcaatcacttctaag
gtcgcactaatatcaggtggtcctggtacaggaaaaactaacactttagctaaattacta
gtagctttattacttattaatactgattcgactaattatagtgcgcgtttgcgtattatt
atcactaccccaaatagtcaaatgatttcacgcttaagggagtatattatgctctctatg
aataatctgatattagataatagtttaagaaacaagatagtatatcagattatgagtata
cctagattgttaggtgtactacctaacagcaaacgcatgcgttataattgtgataataaa
cttaatgtagatatattaattattgatgacgcatcaatgattgatttacagatgatggct
aatattataaatgctattcctaatcaaactaaggtaattttttttggtgattattatcag
ttagcatctgtagaaacaggagcagtattcagggatatttgtaaatttgcagatactagt
ggttacagcgaaatacgctctcaatatttagtaagtttaactagttgtagaaaaatattc
tatagatcagaaaataattataggcagaacaaaatagcagacatattctgttgtttaaga
acaaattacagatttaaagatagttctggcattagccatttagctaatgctattaaagct
gggaatataaaagatactattgctttgcttaattctataaaatatccagaaattaattat
ataccaagatcaaataaaaatgattacaaaaatatggtagatgattttgttactggctac
caatactatctaaaattagtacatcaaggtaaatcacatcacaaaatactagaatatttt
aataaataccggatacttgctgtactaagagaaggtcaatttggcgtaaataacttaaat
agcagtattgagcatgctttaatttgctacggtcttattaagaaaacaattagctttagt
tgttatgttggtcaaccaataataattatgcgtaactcgccgttattagaattatataat
ggggatattggtatcgtgcttttagatagtaagcatacaagactacttgcatattttcca
ttatatgatggaaccattaaaacagtacctataaactgtctaccaaagtatgaaacagct
ttcacaatcacagtacatcaatcaataggatcagaatttactaatactgcgttagtacta
ccagataatattttgccagtattgacccgtgaacttttatatactggagttactagagca
tgcaaaaatttgtctatttatgcacctcataataaggaggtattagttcatacgattaat
agtactattaatcgtcgtagcggacttaaagaaaagttactaataattgagtaa

DBGET integrated database retrieval system