KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_497
Entry
AB162_497         CDS       T04544                                 

Gene name
dnaB
Definition
(GenBank) Replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_497 (dnaB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_497 (dnaB)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AB162_497 (dnaB)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    AB162_497 (dnaB)
SSDB
Motif
Pfam: DnaB_C DnaB AAA_25 ATPase NB-ARC
Other DBs
NCBI-ProteinID: AKZ66080
UniProt: A0A0K2BL86
LinkDB
Position
525012..526412
AA seq 466 aa
MSEKKTTYKVNLPIDMKVEALKIPPHSLEAEQSVLGGLMLDNKRWDNVSERLTTNDFFNN
QHRLIFREMQILIDISQPIDLITLAESLEQKGQLEAVGGFAYLAELSKNTPSVANISAYA
DIVRERAVVREMINVAHEIANAGYNPQGRSSEYLLDLAESMIFQIAENRAHKDEGPKSID
FVLEKTVAHIEQLYKKPNHGITGVSSGYLDLDKKTAGLQKSDLIIVAARPSMGKTTFAMN
ICENAAMTEEKPVLIFSLEMSGEQIMIRMLASLSRVDHTSIRTGTLNDDDWARISSTMGI
LLDKRNLLYIDDSSGLTPTEVRSRARRIFREHDGLSLIMIDYLQLMRVPALSDNRTLEIA
EISRSLKALAKELQVPVLALSQLNRSLEQRADKRPINSDLRESGSIEQDADLIMFIYRDE
LYHDNSDMKGIAEIIIGKQRNGPIGTVRLTFNEQWSRFDNYAGMYD
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgtcagaaaaaaaaacgacttataaagtaaatttaccaatagatatgaaggtagaggct
ttaaaaattccaccacattctttggaagctgaacagtctgtactaggcggcttaatgcta
gataataagcggtgggataatgtttcagaacgtttaacaacaaatgatttctttaataat
cagcacaggttaatttttagagaaatgcagattttaattgatattagtcaacctatcgat
cttattactctggccgaatctttagaacagaaaggtcagctagaagctgttggtggtttt
gcttatctagctgagttatctaaaaatacccctagtgtagctaacatatctgcttacgca
gatattgtccgcgaacgtgctgtagtacgtgaaatgattaatgtagctcatgaaatcgca
aatgctggatataatccacagggacgtagtagtgaatatttgctagatttagcagaatct
atgatatttcagatagctgaaaatagggctcataaagatgaaggtcctaaaagcattgac
tttgttttagaaaagactgtggctcatattgagcagctgtataaaaaaccaaatcatggg
ataactggagtctctagtggttatctagacctagataaaaaaacagctggactacaaaaa
tctgatttgatcatagttgcagcacgaccatcaatgggtaaaacaacttttgctatgaat
atatgtgaaaacgctgctatgactgaggaaaagccagtactaatttttagcttagaaatg
tctggtgaacagataatgatacgtatgttagcttcattatctcgtgttgatcatactagt
atccgtactggtacgctaaatgatgatgattgggcacgtatatctagtactatgggtatt
ttattagataagcgtaatctgttatatattgatgactcatctggtttaacaccaacagaa
gtacgttcaagagctcgtcgtatttttcgtgaacatgatggtttaagcctaattatgatt
gattatttacaactaatgcgtgttccagcactttctgataacagaacgctagaaattgca
gaaatctcacgttcgcttaaagccttagctaaggagctacaagtacctgtattagcgttg
tctcagctaaatagaagcctagaacaacgtgctgataagcgacctattaattcagactta
cgtgaatccggttctatagaacaggatgctgatttaattatgtttatctatcgtgatgaa
ttgtatcatgataatagtgatatgaagggcatagcagaaattattattgggaaacaacgt
aatggtcctatcggtactgtacgtttaacttttaatgagcagtggtctagatttgataat
tatgctggtatgtatgattaa

DBGET integrated database retrieval system