KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_529
Entry
AB162_529         CDS       T04544                                 

Gene name
mutL
Definition
(GenBank) DNA mismatch repair protein
  KO
K03572  DNA mismatch repair protein MutL
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AB162_529 (mutL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_529 (mutL)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Molecular matchmaker
     AB162_529 (mutL)
SSDB
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c
Other DBs
NCBI-ProteinID: AKZ66109
UniProt: A0A0K2BLP6
LinkDB
Position
complement(557668..559443)
AA seq 591 aa
MPIIILSKQLVNQISAGEIVERPASVVKELVENSLDAGATHIDINIENGGMKTIRIRDNG
SGISKNELILALARHATSKISTIEDLESITSMGFRGEALASISSVARITITSRITEQNEA
WQASAEAYKDNIASISIKPAAHPVGTTVEVQDLFYNTPARRKFMRTDKTEFKNIEEVIRI
IALARFDVTFIVQHNNKNVQLYRAVRDNSQYLRRLSSICGIRFVKRALVLCWQYSDITVS
GWTEDSDKPEKNEYFPIIKYSYVNQRVIRNKLINHAISQAYQEQLNGIRSPAFVMFITMN
PNQIDINVHPAKKDVRFHNERLVHHVIYQAVVTVLQKKIKPYLDTTNYIPIPLCSNKLQA
VTEPDKANELVSNSTRVIIYNKQHKNNICTKEKNINTAANISSDYKNSFGRLLTVYYPCY
ALLEAAHGLSLLSLKFANIYITERQLTPEKDNIISHSLLIPIRMTLSKDETVTLYKNIVF
LKNIGIVLQANESQVILNAVPLPLLRKKNLHNLIIELLVYLNSEYLITSKKIAAWLARNI
NNETTTIWSYYRAIPLIAEIERLCPHWVNNPPNSLIVKLNVEAAIKKLNYE
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgcctattattatactatcaaaacaattagttaaccaaatatcagcaggagaaattgta
gaacgccctgcatcggtagtcaaggaattggtcgaaaatagcctagatgctggtgctaca
catattgatattaatatcgaaaatggaggaatgaaaactatacgtatccgtgacaatgga
agcggaattagtaaaaatgaactaatactagctcttgcgcgccatgcaactagcaaaata
tctactatagaagatttagagtctattaccagtatgggatttcgcggggaagccttagct
agtattagttctgttgctcgcattactataacttcacgcataactgaacaaaatgaagct
tggcaggcatcagcggaggcttataaagacaatatagcatccattagtattaagccagca
gcacatccagtaggtactacagtggaagttcaagatttattttataataccccagctagg
cgtaagtttatgcgtaccgataaaactgagtttaagaatattgaagaagtaattcggata
atagcactagcaagattcgatgtaacatttattgttcagcataataacaaaaacgttcaa
ctatatcgagcggttagagataatagtcagtatttgcgaaggcttagtagtatttgtgga
attagattcgttaaacgagcactagtattatgctggcagtatagcgatataactgtatct
ggatggactgaagattccgataaaccagaaaaaaatgaatattttcctattattaaatat
agttatgtgaatcaacgtgtgatacggaataagctgataaaccatgctatcagccaggct
taccaagaacagttaaatggaattaggtctccagcttttgttatgtttattacgatgaac
cctaaccaaattgatattaatgttcatcctgctaaaaaagatgtaagatttcacaatgag
cggttagtgcaccatgttatttatcaggctgtagtaactgtgttgcaaaaaaaaataaaa
ccatacctagatactactaattatattccaatcccattatgtagcaataaattacaagca
gtaacagaaccagataaagctaatgaattagttagtaactctactagagtaattatttat
aataaacaacataaaaataatatttgtacaaaagaaaaaaatattaatacagcagcaaat
attagtagtgattataaaaatagttttggtcgattattgactgtatactatccttgctat
gctcttttagaagcagctcacggattatcattactatcactaaaattcgctaatatttat
atcactgagcgtcaattaacgcctgaaaaagataatattatatctcattcgctactaatt
ccaatacgtatgacattaagtaaagatgaaactgtaacactttacaaaaatattgttttt
ttgaaaaacattgggattgtgctgcaagctaatgagtctcaagtaatacttaatgcagta
ccattaccattattaaggaaaaaaaatttacacaacttaattatagaactattagtgtac
cttaatagtgaatatttaataacatctaaaaaaattgcagcatggcttgcacgtaatata
aataatgaaactactactatatggagctattatagggcaattccattaattgcagaaatt
gagagactttgtccacattgggtaaacaatcctcctaattcgcttattgttaaattaaat
gtagaagctgctattaaaaaattaaactatgaataa

DBGET integrated database retrieval system