KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_560
Entry
AB162_560         CDS       T04544                                 

Gene name
dnaG
Definition
(GenBank) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_560 (dnaG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_560 (dnaG)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     AB162_560 (dnaG)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    AB162_560 (dnaG)
SSDB
Motif
Pfam: Toprim_N DnaG_DnaB_bind zf-CHC2 Toprim_4 Toprim_2 DnaB_bind Toprim Toprim_3
Other DBs
NCBI-ProteinID: AKZ66137
UniProt: A0A0K2BLS1
LinkDB
Position
complement(590419..592062)
AA seq 547 aa
MACCPFHNDKIPSFNVSSEKQFYHCFSCGSNGNAIDFMMNYDRLEFIETIEELATMCGLD
IPYETYLYSNNNTNYSRQNIFYMMNKLSKFYQHILIKKDFLVKNFLKQRGLSKIVINNFA
IGFAPPGWDNVIKYFGCSDKEIALLKAAGMVIKNNNGDIYDRFRNRVMFPIRDQRGRILA
FGGRLIVEGQPKYLNSPETDIFHKSRQLYGLYEAKQKNTVLSRLLVVEGYMDVVTLTQFG
INYAVASLGTNTTTEHIQLLYRNTDQIICCYDGDNAGREAAWRTLKHAIPYLMDGRQLSF
IFLSDGEDPDTLVRKIGKNAFEQYIEQAQPMSKFLFDTLIKKVDLSNIDGRAKLSALALP
LISKIPGRILRLFLRQQLCHKIGLIDDSKLEKMLQYNYNRKQKKYILLQQPKLTNMRILI
GLLVQKPWLSTLVTITNSLYQTKQTGVQLFIKLVKICKLQPELTTGQLLELNRHNKYYSQ
LKNLAQWNHMIIENMIKRTFLDALKRLYDSILEERQEKLIALERTHGISTEERKELWSLN
QILSKKR
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggcttgctgtccgtttcataacgataaaataccttcatttaatgttagtagtgaaaaa
caattttatcactgttttagttgcggttccaatggaaatgctattgattttatgatgaat
tatgatcgtttagaatttatagaaacgattgaagaattagctactatgtgtggcttagat
ataccctacgaaacatatttatactcaaataacaatacaaattattctcgccaaaatatt
ttttatatgatgaataaacttagtaagttttatcaacacatactaataaaaaaagatttt
ttagttaaaaattttttaaaacaacgtggtttgagtaagatagtaataaataattttgct
attggctttgcaccgccaggctgggataacgttataaaatactttggttgttcagacaaa
gaaatagctttactgaaagctgctggtatggttattaaaaataataatggtgatatctat
gatcgtttccgtaatagagttatgttccctattcgtgatcagcgtggtcgtatattagcc
tttggtggtcgtcttatcgtagaaggacaacctaagtatcttaactcgccagaaactgat
atttttcataaaagtcgccagttatacggtttatatgaagctaaacagaaaaatactgta
ttatctaggttactagttgtagaaggctatatggatgtagttacattaacacaatttggt
attaattatgcggtagcttcccttggaacaaacacaactacagaacatattcagttatta
tatcgtaatacagatcaaataatttgttgttatgatggagataatgcaggacgagaagca
gcttggagaacattaaaacatgctattccctatctgatggatggtcgtcaattaagtttt
atatttttgtctgatggagaagatcctgatacgctagtacgtaaaattggtaaaaatgct
ttcgaacaatatattgaacaggcgcaaccaatgtctaaatttttgtttgatactttaatt
aaaaaagttgatctcagtaatatagacggtcgtgctaaactaagcgcattagcactacca
ctaataagtaaaataccaggtcgaatacttcgcttgtttcttagacaacaattatgtcat
aaaattgggctaattgacgatagtaaactagaaaaaatgttgcaatataattataataga
aagcaaaaaaaatatatattactacagcaaccaaaactgactaatatgcgtatattgata
ggattattagtacaaaagccatggctttcgaccttagttacgataactaatagtctttat
cagactaaacaaactggagtacaactttttattaaattagtaaaaatttgcaaattacag
ccagagttaactaccggccaattattagaacttaatcgtcataataaatattactcacaa
ctgaaaaatttagctcaatggaaccacatgatcatagaaaatatgatcaaaagaactttt
cttgatgctttaaagcgtctctatgactcaatacttgaagaacgtcaggaaaaacttatc
gcacttgaacgaacacatggtatttctactgaagagagaaaagaactgtggtcacttaat
cagatattatctaaaaaaagataa

DBGET integrated database retrieval system