KEGG   Burkholderia cenocepacia J2315: BCAL0446
Entry
BCAL0446          CDS       T00771                                 

Definition
(GenBank) putative aminotransferase
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00440  Phosphonate and phosphinate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCAL0446
Enzymes [BR:bcj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BCAL0446
Amino acid related enzymes [BR:bcj01007]
 Aminotransferase (transaminase)
  Class V
   BCAL0446
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-ProteinID: CAR50757
UniProt: B4E7F4
LinkDB
Position
1:complement(492314..493444)
AA seq 376 aa
MTLAAQPILLTPGPLTTSERTRDAMLRDWGSWDGDFNAITARLRERLLQIVHGEGTHECV
PLQGSGTFSVEAAIGTLVPRDGHVLVPNNGAYCQRLAKICRVLGRRLTTIDYREDRRVDP
ADVERALAADPSITHVALVHCETGAGVLNPLHDVAQAVAKHGRALIVDAMSSFGAIDIDA
RTTPFDAVIAASGKCLEGVPGLGFVIAKRSALERCEGNSHSLAMDLYDQWVYMQRTTQWR
FTPPTHVVAALDAAVAQYIDEGGLAARGGRYQRNTRALLDGMRALGFRPFLDPAIQAPII
VTFHAPDDPNYDFKRFYQEVKKRGYILYPGKLTEVETFRVGCIGHFGEAGIPGAVAAIAD
TLRAMGVRRVSAEAAA
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgacgctcgctgcccagcccatcctgctgacccccggccccctgacgacctccgagcgc
acgcgcgacgcgatgctgcgcgactggggctcgtgggacggcgatttcaacgcgatcacc
gcgcggctgcgcgaacgcctgctgcagatcgtgcacggcgaaggcacgcacgaatgcgta
ccgctgcaaggcagcggcacgttttcggtcgaagcggcgatcggcacgctggtgccgcgc
gacggccacgtgctggtgccgaacaacggcgcgtattgccagcgcctcgcgaagatctgc
cgcgtgctcggccgccggctcacgacgatcgactaccgcgaggatcgccgcgtcgatccg
gccgacgtcgagcgcgcgctcgccgccgatccgtcgatcacgcacgtcgcgctcgtgcac
tgcgaaaccggcgccggcgtgctgaacccgctgcacgacgtcgcacaggccgtcgcgaag
cacgggcgtgcgctgatcgtcgacgcgatgagctcgttcggcgcgatcgacatcgacgcg
cgcacgacgccgttcgacgcggtgatcgccgcgtccggcaaatgcctggagggcgtgccg
gggctcggcttcgtgatcgccaagcgcagcgcgctcgaacgctgcgaaggcaacagccac
tcgctcgcgatggacctgtacgaccagtgggtctacatgcagcgcacgacgcagtggcgc
ttcacgccgccgacgcacgtggtcgccgcgctcgacgcggccgtcgcgcaatacatcgac
gaaggcgggctcgccgcgcgcggcggccgctaccagcgcaacacccgcgcgctgctcgac
gggatgcgcgcgctcggcttccggccgttcctcgatccggcgatccaggcgccgatcatc
gtcacgttccatgcgccggacgatccgaactacgacttcaagcggttttatcaggaggtc
aaaaagcgcggctacattctgtatccgggcaagctgaccgaagtggagacgttccgcgtc
ggctgcatcggccatttcggcgaggccgggattccgggcgccgtcgccgcgatcgccgac
acgctgcgcgcgatgggcgtacgccgcgtgtcggccgaagcggcggcatga

DBGET integrated database retrieval system