KEGG   Burkholderia cenocepacia J2315: BCAL0450
Entry
BCAL0450          CDS       T00771                                 

Definition
(GenBank) putative phosphonoacetate hydrolase
  KO
K19670  phosphonoacetate hydrolase [EC:3.11.1.2]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00440  Phosphonate and phosphinate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCAL0450
Enzymes [BR:bcj01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.2  phosphonoacetate hydrolase
     BCAL0450
SSDB
Motif
Pfam: Phosphodiest
Other DBs
NCBI-ProteinID: CAR50761
UniProt: B4E7F8
LinkDB
Position
1:497652..498899
AA seq 415 aa
MNVMTETPVSVEVNGRRYNWMSRPVVVVCVDGCAYEYLEEAAEAGVAPFLRTLLKPGTAL
KGECVVPSFTNPNNLSIVTGVPPAIHGISGNYFYDRDTGAEVLMNDPKYLVAPTVLATFA
ERGARVAVVTAKDKLRRLLGKGLKGICFSSEKADEASVEENGIDNVLELVGKPVPSVYSA
DLSEFVFAAGVRLLETRPIDLMYLSTTDYVQHKCAPGTEGANAFYAMMDTYLQRLDALGA
IVAITADHGMNAKHDDATGEPNVIYLQELFDEWLGHDAARVILPITDPYVVHHGALGSFA
TVYVPATADADALRARLAAVDGIEVVLTGAEGCARFELPPARMGDLIVISKQDVVLGTRR
IKHDLSGLDVPLRSHGGISEQIVPLIFSKPVATDVTGRARLRNFDIIDIALNHLQ
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaacgtcatgactgaaacgcctgtatccgtggaagtgaacggccgccgctacaactgg
atgagccggcccgtggtggtcgtgtgcgtcgatggctgcgcatacgaatatctggaggaa
gccgccgaggccggcgtcgcgccgttcctgcgcacgctgctgaagccgggcaccgcactc
aagggcgagtgcgtggtgccgagcttcacgaacccgaacaacctgtcgatcgtcaccggc
gtgccgccggcgatccacgggataagcggcaactacttctacgatcgcgacaccggcgcc
gaagtgctgatgaacgatccgaagtacctggtcgcgcccaccgtgctcgcgaccttcgcc
gaacgaggggcgcgcgtcgcggtcgtcaccgcgaaggacaagctgcgccgtctgctcggc
aaggggctgaagggcatctgcttctcgtcggaaaaggccgacgaggcgagcgtcgaggaa
aacggcatcgacaacgtgctcgagctggtcggcaagccggtgccgagcgtgtacagcgcg
gacctgtcggaattcgtgttcgcggccggcgtgcgcctgctcgagacgcgcccgatcgac
ctgatgtacctgtcgaccaccgactacgtgcagcacaagtgcgcgcccggcaccgaaggc
gcgaacgcgttctacgcgatgatggacacgtacctgcagcgtctcgacgcactcggcgcg
atcgtcgcgatcacggccgatcacgggatgaacgcgaagcacgacgacgcgaccggcgag
ccgaacgtgatctacctgcaggagctgttcgacgaatggctcggccacgatgcggcgcgc
gtgatcctgccgatcaccgatccgtacgtcgtgcaccacggtgcgctcggctcgttcgcg
accgtctacgtgccggccaccgccgatgccgacgcgctgcgcgcgcggctcgcggcggtc
gacggcatcgaggtcgtgctgacgggcgccgaaggctgcgcgcgcttcgagttgccgccc
gcgcggatgggcgacctgatcgtgatctcgaagcaggacgtcgtgctcggcacgcgccgc
atcaagcacgacctgtcgggcctcgacgtgccgctgcgttcgcacggcgggatctccgag
cagatcgtgccgctgatcttcagcaagccggtcgcgaccgacgtcaccggtcgcgcgcgg
ctgcgcaacttcgacatcatcgacatcgcgctcaaccatctgcagtga

DBGET integrated database retrieval system