KEGG   Burkholderia cenocepacia J2315: BCAL0647Help
Entry
BCAL0647          CDS       T00771                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCAL0647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcj02000]
    BCAL0647
Enzymes [BR:bcj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BCAL0647
Transporters [BR:bcj02000]
 Other Transporters
  Pores ion channels [TC:1]
   BCAL0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: CAR50957
UniProt: B4E970
LinkDB All DBs
Position
1:complement(701342..701956)
Genome map
AA seq 204 aa AA seqDB search
MKLYYWPKTRAFRALWMLEELGVVYELVPIDLRSHEQGSDAFVQVNPMAKLPALDDGSAP
FAESGAVLLYLADRCPGAGLGVAPDDPLRGRFLQWMFFTPTCLEPAMAEKFTGASGNPVA
FGWGNIARVQRALAQALAHSRWLVGDRFTAADLLLASTLKIAFDAHLLPHEGVLGDYVAR
AEDRDAFRRAVAIEQREAARLLHA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactggccgaagacccgggcattccgggcgctgtggatgctcgaggaa
ctcggtgtggtgtacgaactcgtgccgatcgacctgcgctcgcacgagcagggcagcgat
gcgttcgtgcaagtcaacccgatggccaagctgcccgcgctcgacgacggcagcgcgccg
ttcgccgaatcgggcgccgtgctgctctatctcgccgaccgttgcccgggcgccgggctc
ggcgtcgcgcccgacgatccgctgcgcggccgtttccttcagtggatgttcttcacaccg
acctgtctcgaaccggcgatggccgagaaattcaccggcgcgtccggcaatccggtcgcg
ttcggctggggcaacatcgcgcgcgtgcagcgcgcgctcgcgcaagcgctcgcccacagc
cgctggctcgtcggcgaccgcttcaccgcggccgacctgctgctggccagcacgctgaag
atcgcgttcgacgcacatctgctgccgcacgaaggcgtgctcggcgactacgtcgcgcgc
gccgaggaccgcgacgcgttccgccgcgcggtcgcgatcgaacagcgcgaagcggcgcgt
ctgctgcacgcgtga

DBGET integrated database retrieval system