KEGG   Burkholderia cenocepacia J2315: BCAL0705
Entry
BCAL0705          CDS       T00771                                 

Definition
(GenBank) putative D-amino acid aminotransferase
  KO
K00824  D-alanine transaminase [EC:2.6.1.21]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00310  Lysine degradation
bcj00330  Arginine and proline metabolism
bcj00360  Phenylalanine metabolism
bcj00472  D-Arginine and D-ornithine metabolism
bcj00473  D-Alanine metabolism
bcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    BCAL0705
   00330 Arginine and proline metabolism
    BCAL0705
   00360 Phenylalanine metabolism
    BCAL0705
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BCAL0705
   00473 D-Alanine metabolism
    BCAL0705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcj01007]
    BCAL0705
Enzymes [BR:bcj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.21  D-amino-acid transaminase
     BCAL0705
Amino acid related enzymes [BR:bcj01007]
 Aminotransferase (transaminase)
  Class IV
   BCAL0705
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-ProteinID: CAR51014
UniProt: B4E9Q5
LinkDB
Structure
PDB: 
4PBC

Position
1:768383..769309
AA seq 308 aa
MSQAEFEPIVYLSVSAQEELVPLSEARVPVLDRGFIFGDGVYEVVPVYAHDGAHVPFRIE
QHLDRLARSLKKIGIDNPHDAAGWRALIERVVAANAEGLGDGNALVYLQVTRGVAKRGHA
FPANAVPTVFAMTSPLRLPSEEERAKGVRCVTAEDRRWLHCDIKSISLLGNVLMAQHAAE
RDAFETIQLRDENVTEGSSSNVWIVKNGELFAPPRSNKILEGIRYALVEQLADECGIRFV
AREISEVELRSADEIMLTSATKEILPVTSLDDLPVQGGKPGPVFAALYDAYQRAKAREFE
QFDLTRRK
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagccaagccgaattcgaaccgatcgtctacctcagcgtctcggcgcaggaggaactg
gtgccgctgtccgaagcccgtgtgccggtgctcgaccgcggattcatcttcggcgacggc
gtgtatgaagtcgtccccgtttatgcgcacgacggcgcgcacgtgccgttccggatcgaa
cagcatctggaccggctcgcgcgcagcctgaagaagatcggcatcgacaacccgcacgat
gcggcgggctggcgcgcgttgatcgagcgggtggtcgcggcgaacgccgaaggcctcggc
gacggcaacgcgctcgtctacctgcaggtgacgcgcggcgtcgcgaagcgcggccacgcg
ttcccggcgaacgcggtgccgacggtgttcgcgatgacgagcccgctgcgcctgccgtcg
gaagaggagcgcgcgaagggcgtgcgctgcgtgacggccgaggaccgtcgctggctgcat
tgcgacatcaagtcgatctcgctgctcggcaacgtgttgatggcgcagcatgcggccgag
cgcgatgcgttcgagacgatccagctgcgcgacgaaaacgtgacggaaggctcgtcgtcg
aacgtgtggatcgtgaagaacggcgaactgttcgcgccgccgcgcagcaacaagatcctc
gaagggatccgctacgcgctggtcgagcagctggccgacgaatgcgggattcggttcgtc
gcgcgcgagatcagcgaggtcgaactgcgctcggccgacgagatcatgctgacgtcggcc
acgaaggaaatcctgcctgtgacgtcgctcgacgatctgcccgtgcagggcggcaagccg
ggccccgtgttcgcggcgctgtatgacgcgtaccagcgtgcgaaggcacgcgagtttgaa
cagtttgacctaacccggagaaaatga

DBGET integrated database retrieval system