KEGG   Burkholderia cenocepacia J2315: BCAL0845
Entry
BCAL0845          CDS       T00771                                 

Gene name
acpP
Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00998  Biosynthesis of various secondary metabolites - part 2
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BCAL0845 (acpP)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BCAL0845 (acpP)
SSDB
Motif
Pfam: PP-binding
Other DBs
NCBI-ProteinID: CAR51151
UniProt: B4EAV6
LinkDB
Position
1:916559..916822
AA seq 87 aa
MMNALEQELATLIIGELNLEDVPLETVTADTPLYGEGFGLDSIDILEIALLISKKYGFEL
RSDNPDNQTIFATLGALAAYVAAHRTK
NT seq 264 nt   +upstreamnt  +downstreamnt
atgatgaacgcactggaacaagagctcgccacgctgatcatcggcgaactgaatctcgaa
gacgtcccgctcgaaacagtgacggccgacaccccgctgtatggcgaaggtttcgggctc
gactccatcgacatcctggaaatcgcgctgctgatctcgaagaaatacggcttcgaactg
cgctcggacaatccggacaaccagacaatctttgcgacgctcggtgcgctggctgcctac
gtcgccgcgcatcgcacgaagtga

DBGET integrated database retrieval system