KEGG   Burkholderia cenocepacia J2315: BCAL2631Help
Entry
BCAL2631          CDS       T00771                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00620  Pyruvate metabolism
bcj00680  Methane metabolism
bcj00710  Carbon fixation in photosynthetic organisms
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
bcj01200  Carbon metabolism
Module
bcj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAL2631
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BCAL2631
   00680 Methane metabolism
    BCAL2631
Enzymes [BR:bcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BCAL2631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAR52933
UniProt: B4E8C5
LinkDB All DBs
Position
1:2893172..2896141
Genome map
AA seq 989 aa AA seqDB search
MPSPDAPTGTLATAANGRAKTATKPKDPIHQTKPATKAAGAPARKAVAPKAGTRTRDDKD
GPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDDSEAAQTLEKKLRKLT
PEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTVAYALDQLKTTGNASK
RLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQELTARERQYNEAMLRA
RVTALWQTRMLRDSRLTVGDEIENALSYYRATFLDELPALYGDIEAALAEHGLSARVPAF
FQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLGAELSVSNLLVGANDA
VKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVPVRSAGRGAPPVRAIP
YEDSEAFVADLKVLTASLDEHHGASLAAPRLAPLVRAAEVFGFHLASIDLRQSSDIHEAV
VAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSALAQSELGVFEKAREV
RTQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGTLGVPGRDAKNSLMVIPLFETI
PDLRDASRIMRDYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGFLTSNWELYRAELALV
DLFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASKFSNPS
IGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDSAMAAYRALVYETPGFTDYF
FSSTPITEIAELNIGSRPASRKLQDPKQRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAV
SAYLDGAPDAAERTKRVTLLKKMNKTWPFFSNLLSNMDMVLAKTDLAVASRYAQLVSDRK
LRKHVFERIVAEWERTSQALAEITGHEGRLATNPLLARSIKNRFPYLDPLNHLQVELIKR
HRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
ttgccctcccccgacgccccgacgggcaccctcgccaccgccgcgaacggccgtgcgaaa
acggcaacgaaaccgaaagacccgatacatcagacaaaacccgcgacgaaagccgccggc
gcccccgcccgcaaggccgtcgcaccgaaggccggcacccgcacgcgcgacgacaaggac
ggcccgctgttcgaggacatccgcttcctcggccgcctgctcggcgacgtcgtgcgcgaa
caggaaggcgatacggtgttcgacgtggtcgagacgatccgccagaccgcggtcaagttc
cgccgcgaggacgacagcgaagccgcgcagacgctcgagaagaagctgcgcaagctgacg
ccggagcagacggtgagcgtcgtgcgcgcgttcagctatttctcgcatctcgcgaacatc
gcggaagaccgccaccacaaccgccgccgccgcatccacgcgctggccgggtccgcgccg
cagcccggcacggtcgcgtacgcgctcgaccagctgaaaaccaccggcaacgcgtcgaag
cgcctgctgcagcgcttcttcgacgatgcgctaatcgtgccggtgctgaccgcgcacccg
accgaagtgcagcgcaagagcatcctcgatgcgcagcacgacatcgcgcgtctgctcgcg
gagcgcgaccaggagctgaccgcgcgcgaacgccagtacaacgaagcgatgctgcgcgcg
cgcgtgaccgcgctgtggcagacgcggatgctgcgcgactcgcgcctgacggtcggcgac
gagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgacgaactgcccgcgctg
tacggcgacatcgaggccgcgctcgccgagcatggcctgtcggcccgcgtgcccgcgttc
ttccagatgggcagctggatcggcggcgatcgcgacggcaacccgaacgtgaccgcggcg
acgctcgacgaggcgatcaaccgccaggccgcggtgatcctcgaacattatctggaacag
gtgcacaagctgggcgccgagctgtcggtgtcgaacctgctggtcggcgcgaacgacgcg
gtgaaggcgctcgcggccgcatcgcccgaccagtcgccgcaccgcgtcgacgaaccgtat
cgccgcgcgctgatcggcatctacacgcggctcgccgcgagcgcgcgcgtacgtctcggc
gaaggcacggtgccggtgcgcagcgcgggccgcggcgcgccgcccgtgcgtgcgattcca
tacgaggactccgaagcgttcgtcgccgatctcaaggtgctgaccgcgtcgctcgacgag
caccacggcgcgtcgctcgccgcgccgcgcctcgcgccgctcgtgcgcgcggccgaagtg
ttcggcttccatctcgcgagcatcgacctgcgccagagttccgacatccacgaggcggtg
gtcgccgaactgttcgcgcgcgccggcgtcgaggccgactatgcggcgctcgccgaggaa
gacaagctgcgcgtgctgctcgccgcgctcgccgatccgcgcccgctgcgctcgccgtac
ctcgaatactcggcactcgcgcagagcgagctgggcgtgttcgagaaggcgcgcgaggtc
cgcacgcagttcggtgcgcgcgcggtgcgcaactacatcatttcgcatacggaaaccgtc
agcgacctcgtcgaggtgctgctgctgcagaaggagacgggcctgctcgaaggcacgctc
ggcgtgccgggccgcgacgcgaagaacagcctgatggtgatcccgctgttcgagacgatc
cccgacctgcgcgacgcgtcgcgcatcatgcgcgactacttcgcgctgccgggcatcgac
gcgttgatcgcgcatcagggcgccgaacaggaagtgatgctcggctactcggacagcaac
aaggacggcggattcctcacgtcgaactgggagctgtatcgcgcggaactcgcgctcgtc
gacctgttccgcgagcgcaagatcacgctgcggctgttccatggccgcggcggcacggtc
ggccgcgggggcggcccgacctaccaggcgatcctgtcgcagccgccgggcaccgtgaac
ggccagatccgcctgaccgaacagggcgaggtgatcgcgagcaagttctcgaacccgtcg
atcggccggcgcaacctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccg
cagtcgaacgcaccggcgcagttgcccgcgttcgaggccgcgatgcagacgctgtccgac
tcggcgatggccgcgtaccgcgcgctcgtctatgaaaccccgggcttcaccgactacttc
ttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggcagccggccggcgtcg
cgcaagctgcaggacccgaagcagcgcaagatcgaggatctgcgcgcgattccgtggggc
ttctcgtggggccagtgccggctgctgctgaccggctggtacggcttcggcagcgcggtg
agcgcgtatctcgacggcgcgccggacgccgccgaacgcacgaagcgcgtcacgctgctg
aagaagatgaacaagacctggccgttcttctcgaacctgctgtcgaacatggacatggtg
ctcgcgaagaccgatctcgcggtcgcgtcgcgttatgcgcaactcgtgtccgatcgcaag
ctgcgcaagcacgtgttcgagcggatcgtcgcggaatgggaacgcacgtcgcaggcgctc
gcggaaatcaccgggcacgaaggccgcctcgcgaccaacccgctgctcgcgcgctcgatc
aagaaccgcttcccgtatctcgatccgctgaatcacctgcaggtcgagctgatcaagcgt
caccgcgcgggcgacacgaacgcgcggctgcgccgcgggattcacctgacgatcaacggg
atcgcggccggcctgcgcaacaccggctga

DBGET integrated database retrieval system