KEGG   Burkholderia cenocepacia J2315: BCAL2986Help
Entry
BCAL2986          CDS       T00771                                 

Definition
(GenBank) putative amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00970  Aminoacyl-tRNA biosynthesis
bcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCAL2986
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bcj03029]
    BCAL2986
Enzymes [BR:bcj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BCAL2986
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BCAL2986
Mitochondrial biogenesis [BR:bcj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BCAL2986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAR53308
UniProt: B4EB86
LinkDB All DBs
Position
1:3273832..3275208
Genome map
AA seq 458 aa AA seqDB search
MTTFTPFPPLAQLAADLAAGRTTSRALVDTALDRIADPAGQGAVVFTEVDADNARAAADA
HDRLRAAGTVLSPLAGIPVSVKDLFDVAGQVTRAGSRVLDGAPAARTDAVAVARLKRAGA
VLVGRTNMSEFAFSGLGLNPHFGNPRSPYHRDVPGDARISGGSSSGAAASVADGMAAVAL
GTDTGGSIRIPAALCGLTGFKPTASRIPTQGGVPLSTTLDSFGPIGLTVACCALVDRMLA
GLEPHVPAARPLEGVRLGVLTNYVTDGVDADVAAALDTALKHLEAAGAIVTEVRFPALDR
LPEINRFGFSPIEAYAWHRPLLATHRDQYDPRVLTRILKGEPASAADYLDLLAARAAMLD
EAAHTVWSRFDALVAPTVPVVPPRIAELETDDDAFTRTNALILRNPSAFNFLDACGLSLP
CHPRDAAPVGLMLAAAPHRDDALLAIGQSVEAVLNTIR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttcacgccgttccccccgctcgcccagctcgccgccgacctcgccgccggc
cggaccacgagccgcgcgctcgtcgacaccgcgctcgaccggatcgccgatccggcgggc
cagggcgcggtcgtcttcaccgaagtcgatgccgacaacgcccgcgcggccgccgacgcg
cacgaccggctgcgcgccgcgggcaccgtgctgtcgccgctcgcgggcattccggtatcg
gtcaaggacctgttcgacgtcgcgggccaggtgacgcgcgcgggctcgcgcgtgctcgac
ggcgcaccggccgcgcgcaccgatgcggtcgccgtcgcgcggctcaagcgcgcgggcgcg
gtgctggtcggccgcaccaacatgagcgaattcgcgttctcggggctcgggctgaatccg
cacttcggcaatccgcgctcgccgtaccaccgcgacgtgccgggcgacgcgcggatttcg
ggcggctcgtcgtcgggggcggccgcgtcggtcgccgacgggatggccgccgtcgcgctc
ggcaccgacaccggcggctcgatccgcatcccggccgcgctgtgcgggctcacgggcttc
aagccgaccgcgagccggatcccgacgcaaggcggcgtgccgctgtcgacgacgctcgac
tcgttcggcccgatcggcctcacggtcgcgtgctgcgcgctcgtcgaccggatgctggcg
gggctcgagccgcacgtgccggccgcccggccgctcgaaggcgtacggctcggcgtgctg
acgaactacgtgacggacggcgtcgatgccgatgtcgcggccgcgctcgacaccgcgctc
aagcatctggaagccgccggcgcgatcgtcaccgaagtgcgcttccccgcgctcgaccgg
ctgccggagatcaaccgtttcggcttctcgccgatcgaggcgtacgcgtggcatcgtccg
ctgctcgccacgcaccgcgaccagtacgacccgcgcgtgctgacgcggatcctgaagggc
gaacccgcgagcgccgccgactatctcgacctgctcgccgcgcgtgccgcgatgctcgac
gaagccgcgcacacggtctggtcgcgcttcgacgcgctcgtcgcgccgacggtgccggtc
gtgccgccgcgcatcgccgaactcgaaacggacgacgacgcgttcacgcgcaccaacgcg
ctgatcctgcgcaacccgagcgcgttcaacttcctcgatgcgtgcgggctgtcgctgccg
tgccatccgcgcgacgcggcgccggtcggcctgatgctcgcggcggcgccgcatcgcgac
gacgcgctgctcgcgatcggccagtcggtcgaggccgtgctgaacacgatccgctga

DBGET integrated database retrieval system