KEGG   Burkholderia cenocepacia J2315: BCAM0034Help
Entry
BCAM0034          CDS       T00771                                 

Definition
(GenBank) putative short-chain dehydrogenase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR Glyco_transf_4 RmlD_sub_bind Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: CAR53889
UniProt: B4EG20
LinkDB All DBs
Position
2:complement(37551..38273)
Genome map
AA seq 240 aa AA seqDB search
MNRQWAFDGQSVVVTGGTSGIGARTALRFAQAGASVVALGLDAAGPHAPVHDRIRCVELD
VADGAALTRTIAGLPRLGALVNGVGISRHADEYRMDQFEHVLNVNLTSVMRASDAALPAL
AATGGSIVNIASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADHGIRVNAVAPGWIDT
PLSSTLMADTQASRRIVERTPLGRWGTTDEVAEVILFLCSPGASFVTGAVVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcagtgggcgtttgacgggcagtccgtcgtggtgacgggcggcacgtcgggc
atcggcgcgcgcaccgcgctgcggttcgcgcaggccggcgcgtcggtcgtcgcgctcggg
ctcgacgccgccggtccgcacgcgccggtgcatgaccgcatccggtgcgtggaactcgac
gtggccgacggcgcggcactgacgcgcacgatcgccgggctgccgcggctcggcgcgctc
gtcaacggcgtcggcatcagccgccacgcggacgaataccggatggaccagttcgagcac
gtgctgaacgtgaacctgacgtcggtgatgcgggcctccgacgccgcgctgcccgcgctg
gcggccaccggcggcagcatcgtcaatatcgcgtcgatgtacacgtacttcggcagcaag
gaccggcccgcgtacagcgcgagcaagggcggcatcgcgcagctcacgcgttcgctcgcg
caggcgtgggccgatcacggcatccgcgtgaacgcggtcgcgccgggctggatcgacacg
ccgctcagcagcacgctgatggccgacacgcaggcgtcgcgccgcatcgtcgagcgcacg
ccgctcgggcgctggggcacgaccgacgaagtcgcggaagtgatcctgttcctgtgctcg
cccggcgcgtcgttcgtcaccggcgcggtcgtgccggtggacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system