KEGG   Burkholderia cenocepacia J2315: BCAM0037Help
Entry
BCAM0037          CDS       T00771                                 

Gene name
dad
Definition
(GenBank) 2,4'-dihydroxyacetophenone dioxygenase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: CAR53892
UniProt: B4EG23
LinkDB All DBs
Position
2:complement(40697..41230)
Genome map
AA seq 177 aa AA seqDB search
MVDKAVSEFWQNIPAIANPFKPDALPEAYIPNAATDDERYYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDEGNPDGYFDVHSYIAMCKAHYEKVGLGAQAIEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtatccgaattctggcaaaacatcccggcgattgccaatccgttc
aagcccgatgcgctgcccgaagcctacatcccgaacgcggccaccgacgacgagcgctat
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgatggcgaaggaagccgggctcgtgaaccggcactatcacccg
cacgaggtgttcgcgtacacgctgtccgggaaatggggctacctggaacacgaatggacc
gcgacgcgcggcgatttcgtgtacgagacgccgggcgaaggccacacgctcgtcgcgttc
gatcaccccgagccgatgcgcgcgttcttcatcgtcaagggcccgctgatctggctcgac
gacgaaggcaatcccgacggctacttcgacgtgcactcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcaagcgatcgagaagctgttccgctga

DBGET integrated database retrieval system