KEGG   Burkholderia cenocepacia J2315: BCAM0038Help
Entry
BCAM0038          CDS       T00771                                 

Definition
(GenBank) AraC family regulatory protein
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: CAR53893
UniProt: B4EG24
LinkDB All DBs
Position
2:41410..42390
Genome map
AA seq 326 aa AA seqDB search
MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEVEKTDIALPGLG
IADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQRDRCLLAEAGDVVVYDTRVP
YLFGFLTPMRQLLIDIPITTLDDRLDAELAALPLRIAPKPGAGAMLGATLRASVERFMKA
PVERDAARFAEHTRTLIAALVDAEVNGVGASRASLSYLLTAKQYIATHLGEPELGPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDARLRKTSIGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAARDAAG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttttttcacgcacgcgaggttcgacggccgacgtgccggcgcgc
gacaggatggcgtactgggatgcgttcaacgcggcgacgctggtcggcctgcgctgctcg
tcgctgtcgccggccgggctcgaagtggagaagaccgacatcgcgctgccgggcctcggc
atcgccgacatcagcgggcaggatcacgtgatcgagcgcagcccagcgctggtgcgccag
ttgccgaaggaatcgctgttcgcgtgccagatcctgagcgggcgcgcgtatttcatccag
cgcgaccggtgcctgctcgcggaagccggcgatgtcgtcgtctacgacacgcgcgtgccg
tatctgttcggattcctgacgccgatgcggcagttgctgatcgatatcccgatcacgacg
ctcgacgaccgcctcgatgcggagctggccgcgctgccgctgcggatcgcgccgaagccg
ggtgcgggcgcgatgctcggcgcgaccttgcgcgcgagcgtcgagcggttcatgaaggcg
ccggtcgagcgcgacgccgcgcggttcgccgagcacacgcgcacgctgatcgcggcgctc
gtcgatgcggaggtgaacggcgtgggcgcatcgcgcgcgtcgctgtcgtacctgctgacc
gcgaagcaatacatcgcgacgcatctcggcgaaccggaactcgggccgcaggccgtcgcc
gatgcggtcgggctgtcgctgcgacatctggggcgcctcttcgcggccgaaggcgagtcg
atcacgcagcacatctggtcggagcggttgtcgcacgcgcatcgcgaactgaccgacgcg
cggctacgcaagacgagcatcggcgagatcgcgtttcgctgggggttttcgagccaggcg
cacttcagccgcgcgatccgcgagcgctacggcgcgtcgccgatggcgctgcgcgacgcg
gcgcgtgacgccgcgggctga

DBGET integrated database retrieval system