KEGG   Burkholderia cenocepacia J2315: BCAM0039Help
Entry
BCAM0039          CDS       T00771                                 

Definition
(GenBank) putative alcohol dehydrogenase
Organism
bcj  Burkholderia cenocepacia J2315
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO FAD_binding_2 Pyr_redox_2 HI0933_like FAD_oxidored Pyr_redox_3 NAD_binding_8 Lycopene_cycl Amino_oxidase Pyr_redox GIDA OCD_Mu_crystall ApbA FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: CAR53894
UniProt: B4EG25
LinkDB All DBs
Position
2:complement(42486..44051)
Genome map
AA seq 521 aa AA seqDB search
METYDHIVVGGGSAGCTVAHRLVKAGRRVLLLEDGPKDDSLFIRIPATFIRVLGTQRTVT
FESEPQPGAAGRKTYVPQGRTLGGGSSVNAMLYVRGTRDDYDDWAALGCTGWGWDDVLPV
FKRAESHLRLSEPFHGTDGPLKVGDTRFRHPLSLAFVKAAQEAGIAYNDDFNGAAQHGVG
FYHTTIFDGQRGSTAATYLADAIADPNLRVLTGCRVTRIRFDGRRASGVEWRTASGATGA
AVARADVVLAAGALSTPKLLMLSGIGPGAHLHAHGIDVLHDSRDVGAHYQDHLEVSIYGR
TQAPVSLLGEDRGWRALRHGLQWMLCRSGLLTSNVVESGAFVDTTGGGRPDIQFHVLPTL
VGDVDRAPLPGHGLSINPCLLRPRSRGAVQLRGNDPAAPILFDSGALSDPADVEGLVRGV
RLARQILRAPSLARLVREAETLTDAALADYVRRRAKTVYHPAGTCRMGSDAHAVVTPRLA
VQGVDGLRICDASVMPRIVSGNTNAPTIMIAERCAAFMLTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtacgaccacatcgtcgtcggcggcggttcggccggctgcacggttgcgcac
cggctggtgaaggccggccggcgcgtgttgctgctcgaggacggcccgaaggacgacagc
ctgttcatccggattccggcgacgttcatccgcgtgctcggcacgcaacggacggtgacg
ttcgagagcgagccgcagccgggcgccgcgggacgcaagacctacgtgccgcagggccgc
acgctcggcggcggcagctcggtcaacgcgatgctgtacgtgcgcggcacgcgcgacgac
tacgacgactgggccgcgctcggctgcaccggctggggctgggacgacgtgctgccggtg
ttcaagcgcgccgaatcgcatctgcggctgtcagagccgttccacggcaccgacgggccg
ttgaaggtcggcgacacgcgcttccggcatccgctgagcctcgcgttcgtgaaggccgcg
caggaagccggcatcgcgtacaacgacgacttcaacggcgccgcgcagcatggcgtcggc
ttctatcacacgacgatcttcgacggccagcgcggcagcaccgcggccacctatctggcc
gacgcgatcgccgatccgaacctgcgcgtgctgaccggctgccgcgtgacgcgcatccgg
ttcgacgggcgccgcgcgagcggcgtcgaatggcgcaccgcgagcggcgcgacgggagcg
gccgtcgcgcgcgccgacgtcgtgctcgcggccggcgcgctgagcacgccgaagctgctg
atgctgtcgggcatcggccccggcgcgcacctgcacgcgcacggcatcgacgtgctgcac
gacagccgcgacgtcggcgcgcactaccaggatcacctcgaggtatcgatctacggccgc
acccaggcaccggtcagcctgctcggcgaggatcgcgggtggcgggcgttgcggcacggg
ctgcaatggatgctgtgccgctccggcctgctgacgtcgaacgtcgtcgaatcgggcgcg
ttcgtcgatacgaccggcggcggccgcccggacatccagttccacgtgctgccgacgctc
gtcggcgacgtcgatcgcgccccgctgcccggccacggcctgtcgatcaacccgtgcctg
ctccggccgcgctcgcgcggcgccgtgcaactgcgcggcaacgatccggccgcgccgatc
ctgttcgacagcggcgcgctgtcggacccggccgacgtcgagggcctcgtgcgcggcgtc
aggctcgcgcggcagattctccgcgcgccgtcgctcgcccgccttgttcgcgaagccgag
acgctgaccgacgccgcgctcgccgactacgtgcggcgtcgcgcgaaaaccgtctatcac
ccggccggtacgtgccgcatgggcagcgacgcgcacgcggtcgtcacgccgcgtctcgcc
gtgcaaggcgtcgacgggttgcggatctgcgatgcatcggtaatgccgcgcatcgtgtcc
ggcaacacgaacgcgccgacgatcatgatcgcggagcgctgcgcggcgttcatgttgacg
gcgtga

DBGET integrated database retrieval system