KEGG   Burkholderia cenocepacia J2315: BCAM1243
Entry
BCAM1243          CDS       T00771                                 

Definition
(GenBank) putative aminotransferase
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00440  Phosphonate and phosphinate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCAM1243
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcj01007]
    BCAM1243
Enzymes [BR:bcj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BCAM1243
Amino acid related enzymes [BR:bcj01007]
 Aminotransferase (transaminase)
  Class V
   BCAM1243
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: CAR55099
UniProt: B4EHC3
LinkDB
Position
2:complement(1365918..1366982)
AA seq 354 aa
MLLLNPGPVTLTERVRRSLLQPDLCHRESEFFDLQDEARTRLVAAYELDPAEWAAVLMTG
SGTAAVESMIAALVPQDGKLLVIENGVYGERITQIATQYGIAHDVLKHEWMQAPDLARIG
AKLDAGGYSHVAVIHHETTTGRLNDLGAIAEVCRARGVKMLVDGVSSFGAEAIDFAGGVI
DAVAATANKCLHGVPGAAFVIVRRSALTKAASRTYYLDLGRLAKLQDQRNTPFTPSVHAY
YALVEALREFDEAGGWRARHAHYKALADQAQAGLAARGMPLVLPEGASSVVLRAYRLPQG
VTYETLHDGLKARGFVIYAGQGGLSKELFRISTMGAIQAADVERLLEGFTALTR
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctgctgctgaaccccggcccggtcacgctcaccgaacgcgtgcgccgcagcctgctg
caacccgatctgtgccatcgtgaaagcgaattcttcgacctgcaggatgaagcgcgcacg
cgcctcgtcgccgcgtacgaactcgatccggccgaatgggcggccgtactgatgacgggc
tcgggcacggccgccgtcgagagcatgatcgcggcgctcgtgccgcaggacggcaagctg
ctcgtgatcgagaacggcgtgtacggcgagcgaatcacgcagatcgcgacgcagtacggc
atcgcgcatgacgtgttgaagcatgagtggatgcaggcgcccgatctcgcgcggatcggg
gcgaagctcgatgcgggcgggtattcgcacgtcgcggtgatccatcatgaaacgacgacg
ggccggctgaacgatctcggcgcgattgcagaagtgtgccgtgcgcgcggcgtgaagatg
ctcgtggacggcgtcagcagcttcggcgcggaagcgatcgacttcgccggcggcgtcatc
gatgcggttgccgcgaccgcgaacaaatgcctgcacggcgtgccgggtgcggcgttcgtg
atcgtgcgccgcagtgcgctcacgaaggccgcaagccggacttactacctcgatctcggt
cggctcgcgaagctgcaggatcagcggaatacgccgtttacgccttccgtgcatgcgtat
tacgcgctcgtcgaggcgttgcgcgagtttgacgaggctggcggctggcgtgcccggcat
gcgcattacaaggcgcttgccgatcaggcgcaggcagggcttgctgcgcgcgggatgccg
ctggtgctgccggaaggtgcgtcgtcggtcgtgctgcgtgcgtatcggttgccgcagggt
gtcacgtacgagacgctgcacgacgggttgaaggcgcgtggcttcgtgatttatgccggg
caaggcgggctctcgaaggagctgttccggatctcgacgatgggcgcgattcaggcggcc
gatgtcgagcggttgctggaagggtttacggcgctgacgcggtga

DBGET integrated database retrieval system