KEGG   Burkholderia cenocepacia J2315: BCAM1245Help
Entry
BCAM1245          CDS       T00771                                 

Definition
(GenBank) putative phosphoenolpyruvate phosphomutase/sugar nucleotidyltransferase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00440  Phosphonate and phosphinate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
bcj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCAM1245
Enzymes [BR:bcj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BCAM1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: CAR55101
UniProt: B4EHC5
LinkDB All DBs
Position
2:complement(1368160..1369848)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTESTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNV
RGAGVDRLKAMLATLQARPDFDTLDIPSLLNELVAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaggccggcttcaaggggatctgggcgtcgggcctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaagcgagctggacccaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaagacgaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgtgtcgaagcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtacgcggaagccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
cccgacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcctccgcaatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaagaccgcgtcgcatcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcc
tcgcgcgcgtcgaacgcggcgatcgtgctcgccgcgagccgcggcaagggcctggaggcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctcttgcgctgg
ctcgtcgacggcttcaagacgcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccatgcgcagacg
ggcgagctcgcgtcgctcgcgtgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggaaagcgaagccgaa
ttcagcgtcgtggtcgattcgtcgctcaccgagtcgacgaaccagagcgtgcgcgacttc
gccctctgctcggcggccgacgatcgcggcctgttcggccagaagacctacctgcaacgc
gtatcgagcgacgtcgccgcgggcaccccgcacggccgctggatcggcctgctgaacgtg
cgcggcgccggcgtcgaccggctgaaggcgatgctcgcgacgctgcaggcgcgccctgat
ttcgacacgctcgacatcccgtcgctgctcaacgagctggtcgccgcgggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctggaagacttccgccgc
gcgggcgacttcgcgcacggccagacgccgctgtccgagccgggcgccggcaacgggggc
gcgcaatga

DBGET integrated database retrieval system