KEGG   Burkholderia cenocepacia J2315: BCAM2499
Entry
BCAM2499          CDS       T00771                                 

Definition
(GenBank) putative aminotransferase protein
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00440  Phosphonate and phosphinate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BCAM2499
Enzymes [BR:bcj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BCAM2499
Amino acid related enzymes [BR:bcj01007]
 Aminotransferase (transaminase)
  Class V
   BCAM2499
SSDB
Motif
Pfam: Aminotran_5 Beta_elim_lyase UPF0020 DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: CAR56364
UniProt: B4EJ52
LinkDB
Position
2:2835765..2836874
AA seq 369 aa
MSDPILLTPGPLTTSATTRHAMQHDWGSWDAAFNQLTASVCADLVAIAHGGDEYVCVPMQ
GSGTFSVEAALGTLVPRDGVVLVPENGAYCARILKILGRLGIDAIALPFGEDAAVDAAAI
EAAFAREPRITHVALVHLETSAGILNPLDAIAAACRRHGKRLVVDAMSSFGALPIALADS
GIDALISASGKCLEGVPGMGFAIVRRDALDASEGNSPSLALDLHDQYAYLRRTGQWRFTP
PTHVIAALRAALDQYLAEGGQPARGARYADNCRTLVESMRALGFVPFLDASVQAPVIVTF
HAPDHPAYDFRRFYDAVRDAGFILYPGKLTRLETFRVGCIGAIDAGDIRRAVAAIAQAIE
SLGIAMQPA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgtccgacccgatcctgctcacgcccggcccgctcaccacgtccgccacaacacgccac
gcaatgcaacatgactgggggtcgtgggatgccgctttcaaccagctgacggccagcgtc
tgcgcggatctcgtcgccatcgcgcatggcggagacgagtacgtatgcgtgccgatgcag
ggtagcggcacgttctcggtcgaagccgcgctcggcacgctggtgccgcgcgacggcgtc
gtgctggtgcccgagaacggcgcgtattgcgcgcgcatcctgaaaattctcggccggctc
ggtatcgacgcgatcgcgctgccgttcggcgaagacgcggccgtcgacgcggcggccatt
gaggctgcgttcgcgcgcgagccgcgcatcacgcacgtcgcgctcgtgcacctggaaacg
agcgccgggatcctgaatccgctcgacgcgatcgcggccgcgtgccggcggcacggcaag
cggctggtcgtcgatgcgatgagttcgttcggcgcgctgccgatcgcgctggcggacagc
ggcatcgacgcgctgatctcggccagcggcaaatgtctcgaaggcgtgccgggaatggga
ttcgcgatcgtgcggcgcgacgcgctcgacgcgagcgaaggcaactcgccctcgctcgcg
ctcgatctccacgaccagtacgcgtacctgcgcaggacggggcaatggcgcttcacgccg
ccgacgcacgtgattgccgcgctgcgcgccgcgctcgaccagtatctcgccgaaggcggc
cagccggcgcgcggcgcgcgctatgcggacaactgccggacgctggtcgaatcgatgcgc
gcgctcggtttcgtgccgttcctcgacgcgagcgtgcaggcgccggtgatcgtcacgttt
cacgcgcccgaccatccagcctacgatttccgccgtttctacgacgcggtgcgcgacgcg
ggcttcatcctgtatccgggcaaactgacgcggctcgagacgttccgcgtcggctgcatc
ggcgcgatcgatgcgggcgatatccggcgggcggtcgccgcgatcgcgcaggcaatcgaa
tcgctcggcatcgcgatgcagcccgcatga

DBGET integrated database retrieval system