KEGG   Burkholderia cenocepacia J2315: BCAM2561Help
Entry
BCAM2561          CDS       T00771                                 

Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00250  Alanine, aspartate and glutamate metabolism
bcj00410  beta-Alanine metabolism
bcj00640  Propanoate metabolism
bcj00650  Butanoate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BCAM2561
   00650 Butanoate metabolism
    BCAM2561
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCAM2561
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCAM2561
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcj01007]
    BCAM2561
Enzymes [BR:bcj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BCAM2561
Amino acid related enzymes [BR:bcj01007]
 Aminotransferase (transaminase)
  Class III
   BCAM2561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAR56426
UniProt: B4EJR0
LinkDB All DBs
Position
2:2906028..2907311
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIADQLNSFTHTAYQIVPYASYVELAEKINDRAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEFLK
PGSGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcccgcgccgagaacgcggagctgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatcgcggatcaactgaacagcttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctggcggaaaagatcaacgaccgcgcgccgggcgacttc
ccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgagaacgcgatcaagatc
gcgcgtgcggcgaccggccgtccgggcgtgatcgcattctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcactgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgaattc
gtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtg
cagacgggcttcgcacgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacgtgatggacgcggccgcccccggcggcctcggcggcacctacgcgggcaac
ccgctggcggtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaacgcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgaattcctgaag
ccgggttcgggcgagccggatgccgaattcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcccgcaagccgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system