KEGG   Burkholderia cenocepacia J2315: BCAM2561Help
Entry
BCAM2561          CDS       T00771                                 

Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00250  Alanine, aspartate and glutamate metabolism
bcj00410  beta-Alanine metabolism
bcj00640  Propanoate metabolism
bcj00650  Butanoate metabolism
bcj01100  Metabolic pathways
bcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BCAM2561
   00650 Butanoate metabolism
    BCAM2561
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCAM2561
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCAM2561
Enzymes [BR:bcj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BCAM2561
Amino acid related enzymes [BR:bcj01007]
 Aminotransferase (transaminase)
  Class III
   BCAM2561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAR56426
UniProt: B4EJR0
LinkDB All DBs
Position
2:2906028..2907311
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIADQLNSFTHTAYQIVPYASYVELAEKINDRAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEFLK
PGSGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgccgcccgcgccgagaacgcggagctgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatcgcggatcaactgaacagcttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctggcggaaaagatcaacgaccgcgcgccgggcgacttc
ccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgagaacgcgatcaagatc
gcgcgtgcggcgaccggccgtccgggcgtgatcgcattctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcactgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgaattc
gtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtg
cagacgggcttcgcacgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacgtgatggacgcggccgcccccggcggcctcggcggcacctacgcgggcaac
ccgctggcggtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaacgcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgaattcctgaag
ccgggttcgggcgagccggatgccgaattcacgaagcgcgtgcaggcgcgtgcgctcgag
cgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcccgcaagccgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system