KEGG   Burkholderia cenocepacia J2315: BCAM2793
Entry
BCAM2793          CDS       T00771                                 

Definition
(GenBank) putative feruloyl-CoA hydratase
  KO
K18383  feruloyl-CoA hydratase/lyase [EC:4.1.2.61]
Organism
bcj  Burkholderia cenocepacia J2315
Pathway
bcj00998  Biosynthesis of various secondary metabolites - part 2
bcj01100  Metabolic pathways
bcj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BCAM2793
Enzymes [BR:bcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.61  feruloyl-CoA hydratase/lyase
     BCAM2793
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF3389
Other DBs
NCBI-ProteinID: CAR56656
UniProt: B4ELJ1
LinkDB
Position
2:complement(3160780..3161610)
AA seq 276 aa
MSKYDNRWQTVEVKVEAGIAWVTLNRPEKRNAMSPTLNQEMLQVLDAVEFDDEAKVLVLT
GAGAAWTAGMDLKEYFREIDGGPDALQEKVRRDASEWQWRRLRMYGKPTIAMVNGWCFGG
GFSPLVACDLAIAADEAVFGLSEINWGIPPGNLVSKAMADTVGHRRALHYIMTGDTFTGV
EAAEMGLVNSSVPLAGLRDATIALAARLMDKNPVVLRAAKHGFKRSRELTWEQCEDYLYA
KLDQAQLRDPERGREQGLKQFLDDKAIKPGLQAYKR
NT seq 831 nt   +upstreamnt  +downstreamnt
atgagcaagtacgacaaccgctggcagaccgttgaagtgaaagtggaggccggcatcgca
tgggtgacgttgaatcgccccgagaagcgcaatgcaatgagccccacgctgaaccaggag
atgcttcaggtgctcgacgcggtcgagttcgacgacgaggcgaaggtgctcgtgctgacc
ggcgcgggggccgcatggacggccggcatggatctgaaggagtatttccgcgagatcgac
ggcggcccggacgcgttgcaggaaaaggtgcgccgcgacgcatcggaatggcagtggcgc
cgcctgcggatgtacggcaagccgaccatcgcgatggtgaacggctggtgcttcggcggc
gggttctcgccgctcgtcgcgtgcgacctcgcgatcgcggccgacgaagcggtgttcggg
ctgtcggagatcaactggggcatcccgcccggcaacctcgtcagcaaggcgatggccgac
acggtcggacaccgccgcgcgctgcactacatcatgaccggcgacacgttcaccggcgtc
gaagcagcggagatgggcctcgtgaacagcagcgtgccgctcgccgggctgcgcgacgcg
acgatcgcgctcgccgcacggctgatggacaagaacccggtcgtgctgcgcgcggcgaag
cacggcttcaagcgctcgcgcgaactcacgtgggagcagtgcgaggattacctgtatgcg
aagctcgaccaggcgcaactgcgcgacccggagcgcggccgcgaacaggggctgaagcag
ttcctcgacgacaaggcgatcaagccgggtctgcaagcctacaagcgctga

DBGET integrated database retrieval system