KEGG   Bacillus coagulans 2-6: BCO26_0007Help
Entry
BCO26_0007        CDS       T01527                                 

Definition
(GenBank) DNA gyrase, A subunit
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
bck  Bacillus coagulans 2-6
Brite
KEGG Orthology (KO) [BR:bck00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bck03032]
    BCO26_0007
   03400 DNA repair and recombination proteins [BR:bck03400]
    BCO26_0007
Enzymes [BR:bck01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     BCO26_0007
DNA replication proteins [BR:bck03032]
 Prokaryotic type
  DNA Topoisomerases
   BCO26_0007
DNA repair and recombination proteins [BR:bck03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      BCO26_0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: AEH52067
UniProt: F7Z111
LinkDB All DBs
Position
7051..9525
Genome map
AA seq 824 aa AA seqDB search
MADTPESNIVEVNLTQEMRTSFLDYAMSVIVSRAIPDVRDGLKPVHRRILYAMNDLGMTP
DKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSYRYMLVDGHGNFGSVDGDPAAA
MRYTEARMSKISLELLRDINKDTIDFQDNYDGSEKEPAVLPSRFPNLLVNGSSGIAVGMA
TNIPPHQLGEVIDAILALSKDPDITIQELMEYIPGPDFPTAGLIVGRSGIRRAYETGRGS
ITLRARVEIEQRSNGKESIIVTELPYQVNKAKLIERIAELVHEKRIDGITDLRDESDRNG
MRMVIEVRRDANANVILNNLYKHTAMQTTFGINLLALVAGQPKVLNLKQALKFYLDHQEE
VIRRRTAFELKKAEARAHILEGLRIALDHIDAIIQLIRSSQTTDIARTGLMEQFSLSEKQ
AQAILDMRLQRLTGLEREKIEEEYRGLIQLIAELKAVLADEEKVLEIIREELLEIKERFN
DERRTEIIAASVDHIEDEDLIPQESIAITLTHNGYIKRLPISTYRSQKRGGRGVQGMGTN
EDDFVEHLLTTSTHDTILFFTNKGKVYKKKGYEIPEYGRTAKGIPIVNLLEIDRDEWINT
MIRVEDFVEDWFLFFTTKKGISKRTPVTEFANIRTNGLIAIHLKEEDELISVKMTDGHKE
IIIGTKNGMLIRFPETDVRSMGRSATGVKGITLSGDDEVVGMEILEENDDVLIVTKNGYG
KRTKGSEYRIQSRGGKGLKTCNITSKNGPLIAVKTVTGEEDVMLITAGGVLIRMAVGDIS
VLGRNTMGVKLIRLGDEEYVATVAKVEKDEEENHADPVEETGEE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggctgacacaccggaatcgaatattgtggaagtaaacttaacccaggagatgcgcaca
tcttttcttgactatgcgatgagcgtcatcgtatcccgggccattccggatgtacgggac
ggattaaagcctgtgcaccggagaattttatatgcgatgaacgatctcgggatgactcct
gataaagcgtataaaaaatcggcgcgtatcgtcggggaagtcatcgggaaatatcacccg
cacggcgattcggccgtgtatgaaacaatggtgcggatggcgcaggatttcagctaccgc
tatatgctggttgacgggcacggcaacttcggatcggttgacggcgacccggctgctgcc
atgcgttacacggaagcgcgcatgtcaaaaatttcccttgaactgctgcgcgatattaac
aaagatacaattgattttcaggacaactatgatggttcggaaaaggagccggctgtcctg
ccttcccgttttccgaatctgttggtgaacggttcttccgggattgcggtcggcatggca
acgaacattccaccgcatcaactcggtgaagtcatcgacgcgattcttgctttaagcaaa
gacccggatatcacgatccaggaattgatggaatatatcccagggccggatttccctacg
gccggtttaattgtcggaagaagcggcatccgccgtgcttatgaaacgggaagaggctct
atcacacttcgcgcaagggtggaaattgaacaaagatcaaacggcaaagaatccatcatt
gtgaccgaactgccttaccaggtcaacaaagccaaattgatcgaacggattgcagaactt
gtgcatgaaaagcggatcgacggcattaccgatctgcgtgacgagtccgaccgcaacggc
atgcggatggtgattgaagtccgccgtgatgcaaatgcgaatgtgattttgaacaatttg
tacaagcataccgccatgcagacgacattcggtatcaacctgctggcgcttgttgcaggc
cagccaaaagtgctgaatttaaaacaggcgcttaagttttatcttgaccatcaggaagaa
gtgatccgccgcagaacggcttttgaactgaaaaaagcggaagcgcgtgcccatattttg
gaaggcctgcgcattgcacttgaccatattgatgcgattatccagctgatccgttcctcg
caaacaacggatattgcccgtaccggcttaatggagcaattttccctgtccgaaaagcag
gcacaggcaattctcgatatgcggctgcaacgtttgaccgggctggaacgcgaaaaaatt
gaagaagaataccggggcttgatccaactgattgcagaactgaaagccgttttggcagat
gaagaaaaagtgcttgaaatcatccgtgaagagctgctcgaaattaaagaacggtttaat
gatgaacggcgcacggaaattatagcagcaagcgttgaccatattgaggacgaggatttg
atcccgcaggaaagcatcgccatcaccctgacccataacggctatatcaaacgcctgccg
atttcgacgtaccggagtcagaaacgcggcggccgcggcgtgcaggggatgggcacgaat
gaagacgattttgttgaacatctcttaacgacatcaacacatgatacgatccttttcttc
acaaataaaggaaaagtctataagaagaaaggatacgaaatcccggaatacggcagaaca
gcaaaaggcattccgattgtcaacctgcttgaaattgacagggatgaatggatcaatacg
atgatccgtgtggaagatttcgtagaagactggtttttattttttaccacaaaaaaaggc
atttcaaaacgcacgcctgtaactgaatttgccaatatccggacgaacggcctgattgcc
attcatctgaaagaagaagatgagctgatttccgtaaaaatgacggacggccataaagaa
atcattatcggtacgaagaacggcatgctgatcagatttcccgaaacggatgtccgttca
atgggaagatcggcaacaggggtaaaaggcattaccttaagcggcgatgatgaagtggtc
ggcatggagattctggaagaaaacgatgatgtgcttattgtgaccaaaaacggctatgga
aaacggacaaagggaagcgagtaccgcatccagagccggggcggaaaaggtttgaaaacc
tgcaatatcacaagcaagaacggcccgcttattgctgtgaagacggtaacgggagaagaa
gatgtcatgctcattacagcgggcggcgtgctgatccggatggctgtcggggatatttcg
gtgctcggcagaaatacaatgggcgtcaaactgatccgtcttggtgacgaagaatatgtt
gccacagtcgcaaaagtggaaaaagatgaagaagaaaatcatgctgatccggtggaagaa
accggagaggaataa

DBGET integrated database retrieval system