KEGG   Bacillus coagulans 2-6: BCO26_0060Help
Entry
BCO26_0060        CDS       T01527                                 

Gene name
yacC
Definition
(GenBank) Hsp33 protein
  KO
K04083  molecular chaperone Hsp33
Organism
bck  Bacillus coagulans 2-6
Brite
KEGG Orthology (KO) [BR:bck00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bck03110]
    BCO26_0060 (yacC)
Chaperones and folding catalysts [BR:bck03110]
 Heat shock proteins
  HSP33
   BCO26_0060 (yacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 Bile_Hydr_Trans
Motif
Other DBs
NCBI-ProteinID: AEH52119
UniProt: F7Z163
LinkDB All DBs
Position
62078..62959
Genome map
AA seq 293 aa AA seqDB search
MADYLIKALAYDGQVRAYAADTTETVGEAQRRHYTWPTASAALGRTLTAGAMMGAMLKGD
EKITIKVEGGGPIGVILADANAHGEVRGYVTNPQTHFDLNKKGKLDVRRAVGTDGTLTVV
KDLGLREHFSGQVPLVSGELGEDFTYYFAASEQVPSAVGVGVLVNPDNTILAAGGFIIQL
MPGTDEKVISEIENKISDTAPISELIREGLSPEEILANLLGKENVQILEKMAVRFECTCS
KEKFASAMIGLGKQELRDMIEEDGQAEAVCHFCREKYHFSREDLEQMLEEAKG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggcggattatttaattaaagcattagcgtatgacggacaggtccgggcatacgctgcg
gacacaacggaaaccgttggagaagcgcaacggaggcactacacctggccgacggcttcc
gccgcgctgggcagaacgttaacagcaggggcgatgatgggggccatgctgaagggggat
gaaaaaattacgatcaaagtggaaggcggcggcccgatcggtgtcattctggcagatgcg
aatgcacacggggaagtccgaggctatgttaccaatccgcaaacccattttgatttaaac
aaaaaaggaaagctggatgtccggcgtgcagtcgggacagacgggacgcttaccgttgtg
aaagacctcggactgcgcgagcatttttcaggccaggttccgcttgtatccggcgagctt
ggcgaagattttacgtattattttgccgcttccgaacaagtgccatctgcagtcggtgtc
ggggtgctggtcaatcctgacaacacgattctggctgccggcgggtttatcatccagttg
atgccgggaacagacgagaaagtcatctcggaaattgaaaataaaatttccgataccgcg
ccgatttccgaactcatccgcgaggggctttcgccggaagaaatattggcaaatctgctc
ggcaaagaaaatgtgcagatattggagaaaatggcagtacggtttgaatgcacctgctcc
aaagaaaaatttgcttctgccatgatcggcctcggcaaacaggagctccgggacatgatc
gaggaagacggacaagctgaagccgtctgccatttttgccgcgaaaaataccatttcagt
cgtgaagatctggaacaaatgctggaagaagcaaaagggtaa

DBGET integrated database retrieval system