KEGG   Bacillus coagulans 2-6: BCO26_0117Help
Entry
BCO26_0117        CDS       T01527                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bck  Bacillus coagulans 2-6
Brite
KEGG Orthology (KO) [BR:bck00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bck03012]
    BCO26_0117
   03029 Mitochondrial biogenesis [BR:bck03029]
    BCO26_0117
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bck04147]
    BCO26_0117
Translation factors [BR:bck03012]
 Eukaryotic Type
  Elongation factors
   BCO26_0117
 Prokaryotic Type
   BCO26_0117
Mitochondrial biogenesis [BR:bck03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BCO26_0117
Exosome [BR:bck04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BCO26_0117
  Exosomal proteins of breast cancer cells
   BCO26_0117
  Exosomal proteins of colorectal cancer cells
   BCO26_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase DUF1392
Motif
Other DBs
NCBI-ProteinID: AEH52176
UniProt: F7Z1B7
LinkDB All DBs
Position
128108..129295
Genome map
AA seq 395 aa AA seqDB search
MAKQKFDRSKEHCNIGTIGHVDHGKTTLTAAITAVLAKQGKAEARAYDQIDGAPEERERG
ITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPEYEAKILELMDAVDEYIPTPQRDTDKPFMMPVEDVFSITGRGTVATGRVERGQLKVG
DVVEIVGLSDKPKQTTVTGVEMFRKILDYAEAGDNIGALLRGIAREEVQRGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
SVELIAPIAIEEGTKFSIREGGRTVGAGSVSSIEA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaaaatttgaccgttctaaagaacactgtaacattggaacaatcggtcac
gttgaccatggtaaaacgactttgactgctgcaattactgctgttcttgcaaaacaaggg
aaagcagaagcaagagcatatgaccaaattgacggtgctccggaagaacgcgaacgcggt
attaccatcaacactgcgcacgttgaatatgaaacggaaaaacgccactacgcacacgtt
gactgccctggacacgctgactatgtgaaaaacatgattactggtgctgcccaaatggac
ggcgcgatcctggttgtatccgctgctgacggcccaatgccgcaaacgcgcgaacacatc
cttttgtcccgccaagttggtgtgccttacatcgttgtgttcctgaacaaatgcgacatg
gtggacgacgaagaattgcttgaacttgttgaaatggaagttcgtgaccttctttccgaa
tacgacttccctggcgatgaagtgccggttatcaaaggctctgctttgaaagctcttgaa
ggcgaccctgaatacgaagcaaaaatccttgaattgatggatgctgttgacgaatacatc
ccgactccgcaacgtgacacggataaaccgttcatgatgccagttgaagacgtattttcc
attaccggccgtggtacagttgcaaccggccgtgtagaacgcgggcaattgaaagtcggc
gacgttgttgaaatcgtaggtttgagcgacaaaccaaaacaaacaacggttaccggcgtt
gaaatgttccgtaaaattcttgactatgctgaagctggcgacaacatcggtgcacttctc
cgcggtattgcacgtgaagaagtacaacgcggccaagttttggcgaaaccgggttctatt
acaccgcataccaaatttaaagcacaagtttatgtattaacgaaagaagaaggtggacgc
cacactcctttcttctctaactaccgtccgcaattctacttccgtacaacggacgtaacc
ggcattattactctgccagaaggcgttgaaatggttatgcctggtgataacgttgaaatg
agcgttgaattgattgccccgatcgcgatcgaagaaggaacaaaattctcgatccgtgaa
ggcggccgtacagttggcgccggttctgtttcttccatcgaagcttaa

DBGET integrated database retrieval system