KEGG   Bacillus coagulans 2-6: BCO26_1275Help
Entry
BCO26_1275        CDS       T01527                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00020  Citrate cycle (TCA cycle)
bck00310  Lysine degradation
bck00380  Tryptophan metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
Module
bck_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bck_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCO26_1275
  Amino acid metabolism
   00310 Lysine degradation
    BCO26_1275
   00380 Tryptophan metabolism
    BCO26_1275
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BCO26_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEH53334
UniProt: F7Z7D4
LinkDB All DBs
Position
1329340..1332171
Genome map
AA seq 943 aa AA seqDB search
MNATTPKGFWESFSGPNLGYVMDLYEQYLEDPDSIDEEARKVFDQWGAPAVSEGGSLTQG
QADISFQLPANPTIFSKMVAAVKLADNIRTFGHLAADINPLQKPVGDVRRIELGEFDLTE
EDLKKVPASFICPDAPKRVKNGLDAINYLKEVYTQKVAFEFDHIHDMEEKHWLQRTVESG
SFFRELGREQKIGILKRLSDVEGFEKFIHRTFVGQKRFSIEGLDALVPLMEQMIMEAVKT
GVKTVNIGMAHRGRLNVLAHILEKPYELIFAEFKHASNKDLIPSEGSIGITYGWTGDVKY
HLGADRKGQNGGPIGARIVLANNPSHLEVANPVVEGYTRAAQDNRNKAGYPDRDPDRAFA
ILVHGDAAFAGQGIVAETLNMSKLNGYGTGGTIHIIANNNIGFTTETYDSRSTKYASDPA
KGYEVPILHVNADDPEACVQAALFAYAYREKFHKDFVIDLVGYRRYGHNEMDEPMVTNPV
MYHAVHNHPTVRAIYGEQLVKEGVLTAEEVKTIDEAVQKKLQAAYEKVPDGEAEPDTAME
PPENVKKGYLSMKTGVPEQELRAWNAELLAWPENFHVFKKLARILKRREHVFDGKGKIDW
AHAEALAFAAILKDGVPIRFTGQDTQRGTFAQRNLVLHDEQTGEEYIPHHHLSGVQTSFA
IYNSPLTEAGVVGFEYGYNVFSPDTLVIWEAQFGDFANMAQVMFDQFISSGRAKWGQKSG
LVMMLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANVSTAGQYFHILRRQAKWLAKEEI
RPLVLMTPKSLLRHPLASVEPSVLVDGKFHTVLEGPDTENTGAVERILLCSGKVAVDLEE
KLDGADMSWLHTVRVEQIYPFPEQELKEIFARFKNAKEIVWMQEEPENMGSWSFVEPYLR
KLAPQGAEIRYIGRPRRSSPSEGDPVVHKKEQNIILTEAITRP
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaactacaccaaagggattttgggaaagtttttccgggcctaatcttgggtat
gtcatggatttatatgaacaatacctggaagatccggacagcatcgacgaagaggcgaga
aaagtatttgaccagtggggcgcgcccgctgtttccgaaggcgggagcctgacacagggg
caggcggatatttctttccaattgccggcaaacccgacgattttcagcaaaatggtcgct
gctgtcaaattggcggacaatatccggacttttggccatctcgcagcggatatcaacccg
ctccaaaaacctgttggggatgtcagaagaattgaactgggagaatttgatttaaccgaa
gaagatttgaaaaaagtgccggcatcctttatttgcccggatgcacccaaaagggtcaaa
aacgggcttgatgccatcaattatttaaaagaagtgtacacccaaaaagtcgcctttgag
tttgaccatattcatgacatggaagaaaagcactggctgcaacggacagttgaatcgggc
agctttttccgcgaactcggccgggaacagaaaatcgggattttaaaacgcctttcagat
gtggaaggatttgaaaaatttattcaccggacatttgtcgggcagaagcgtttttccatt
gaagggcttgatgcgctcgttccgctgatggaacaaatgatcatggaagcggtcaaaacg
ggtgtgaaaaccgttaatatcggcatggcgcacagaggccgactcaatgtgcttgcccat
attcttgaaaaaccatacgagctcatttttgcggaatttaagcatgcttccaataaagat
ttaatcccttccgaaggatcgatcggcattacgtacggatggaccggcgatgttaaatac
catctcggcgcggacagaaaagggcaaaacggcggtccgatcggcgcgcgtatcgtgctt
gccaacaacccaagccatctggaagttgccaaccctgttgtcgaagggtatacacgtgcc
gcgcaggataaccggaacaaagcgggctatccggaccgcgatccggaccgcgcatttgcg
attcttgtccacggggatgccgcatttgcggggcagggcattgtcgcagaaacgctgaat
atgagcaagctgaacggatacgggacaggcgggaccatccatatcatcgccaataacaat
atcgggtttacgaccgaaacatacgactcgaggtcaacaaaatatgcttctgatccggca
aaaggctatgaagtgccgatcctccatgtgaatgcggatgatccggaagcatgcgtacag
gcggcgctgtttgcttatgcttaccgcgaaaaattccataaagactttgtgatcgacctg
gtcggctaccgccgctacggccataatgaaatggatgaaccgatggtaaccaacccggta
atgtaccatgcggtgcacaatcatccgacggtcagggccatctacggtgaacagcttgta
aaagaaggcgtcctgacagccgaagaggttaaaacgattgatgaagccgttcagaaaaaa
ctgcaggcggcttacgaaaaagtgccagacggcgaagcagaacccgatacggccatggag
cccccagaaaatgtgaaaaaaggctatttgagcatgaaaacaggggtgccggaacaggaa
ctgagggcttggaatgctgaattgctcgcctggcctgaaaacttccacgtctttaaaaaa
ctggcgcggattttgaaacgccgcgaacacgtttttgacggcaaagggaaaattgactgg
gcccatgcggaagcgctcgcgtttgcagccattttaaaagatggcgtgccgatccggttt
accggccaggatacacagcgcggcacgttcgcacagcgcaatctcgtcctgcacgacgaa
cagacgggggaagaatatattccgcaccatcatctgtccggcgttcaaacttcatttgcc
atttataacagcccgctgaccgaagccggcgttgtcgggtttgaatacggctataacgtc
ttttcgccggatacgctcgtcatttgggaagcccagttcggcgattttgcaaacatggca
caggtcatgtttgaccagttcatttcatccggcagggcaaaatgggggcaaaaatcaggg
cttgtcatgatgctgccgcacggatacgaagggcaaggccctgaacattcaagtggcagg
gtggaacgcttcctgcaactggcagcggaaaacaactggacagtggcgaatgtctcgaca
gccggccaatacttccatattttaagaaggcaggcaaaatggctggcaaaagaagaaatc
cgcccgctcgttctcatgacgccaaaaagcctgcttcgccacccgctggcatctgtagag
ccgtctgtactggtagatggcaaattccacaccgtgctggaaggcccggatacggaaaat
acgggtgcagtcgaaagaatcctgctttgcagcgggaaagtggctgtagacttggaagaa
aagctggacggtgcggacatgagctggttgcatacggtaagggtcgagcaaatctatcct
ttccctgaacaggaattgaaggaaatcttcgcgcgctttaaaaacgcgaaagaaattgta
tggatgcaggaggagccggagaatatgggttcctggtcttttgttgaaccgtatttaaga
aagttggcgcctcagggagcagaaatccgatacatcggccggccgagaaggtcaagcccg
tcggaaggcgacccggtcgtccataaaaaagaacaaaacataattctgactgaagccatt
acccgcccttaa

DBGET integrated database retrieval system