KEGG   Bacillus coagulans 2-6: BCO26_1788Help
Entry
BCO26_1788        CDS       T01527                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bck  Bacillus coagulans 2-6
Brite
KEGG Orthology (KO) [BR:bck00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCO26_1788
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BCO26_1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored K_oxygenase Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 Thioredoxin_4 Glutaredoxin NAD_binding_8 FMO-like Nitrate_red_del DUF2190
Motif
Other DBs
NCBI-ProteinID: AEH53847
UniProt: F7Z5I7
LinkDB All DBs
Position
complement(1817574..1819130)
Genome map
AA seq 518 aa AA seqDB search
MILDEEIKAQLAQYLQMMEGDVLLKVSAGSDETSRNMLELVDQLAAMSPRIKVENTKLER
TPSFSVNRPGEDTGIIFAGVPLGHEFTSLVLALLQVSGRPPKVDQKVIDQIQSIKGEYHF
ETYVSLTCQNCPVVVQALNIMSVLSPNITHTMIDGAAFKEEAEGKGIMAVPSIYLNGEFF
ESGRMEVEEILAKLGSTADPSEFEKKDPFDVLVIGGGPSGASAAIYAARKGIRTGIVTER
IGGQVLDTVGIENLIGTKYTEGPQLAANLEEHVKQYNVDIMNLQRAKRVEKKDLVEVELE
NGAVLKSKTVIISTGARWRNINVPGEAEFKNKGVAYCPHCDGPLFAGKHVAVIGGGNSGI
EAAIDLAGVVKHVTVIEFMPELKADRVLLERLYSLPNVTVVKNAQTKEITGTDKVNGITY
IDRATGEEHHIELEGVFVQIGLVPNTEWLGDTVERTPRGEIVVDKRGATSVPGVFAAGDC
TDSAYKQIIISMGSGATAALAAFDYIIRETKTDEAVHN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatgaagagattaaagcgcaactggcccagtatctgcaaatgatggagggc
gacgttctgctgaaagtgagcgcgggttccgatgaaacatcgcggaatatgctcgaactg
gtcgaccaattggccgccatgtcgcctcggataaaagtggaaaacacaaaactcgaaaga
accccgagtttcagtgtaaaccgtccgggagaagacaccgggattatattcgcgggcgtg
ccgctcgggcatgagtttacatcgctcgttttggccctgctgcaggtcagcggccgccct
cctaaagtggatcagaaggtcattgaccagattcaaagcataaaaggcgaataccatttt
gaaacctatgtcagcttgacttgccagaactgtcctgttgtggtacaagccttgaacatc
atgagtgtgctcagtccgaatattacgcacacgatgattgacggggctgcatttaaagag
gaagcggaaggaaaaggcattatggccgtcccttccatttatctgaacggcgaattcttt
gaaagcggccggatggaagtggaagaaattcttgccaagcttggcagcacagcggatccg
tccgagtttgaaaagaaagacccgtttgatgtgctcgtcatcggcggtggaccgtccggc
gcaagtgcagccatttatgcggcacgcaaaggcatccggacagggattgtcactgaacgc
attggcgggcaggtgctcgatacagtcggcattgaaaacctaatcggcacgaagtatacg
gaaggcccgcaacttgctgcaaaccttgaagagcatgtcaaacagtataatgttgatatt
atgaatctgcagcgtgcaaaacgggtcgaaaagaaagatctcgttgaggtggaattggaa
aacggggctgtattaaagagtaaaaccgtgatcatctccaccggtgcacgctggcgcaac
atcaacgtgccgggcgaagcagaattcaaaaacaaaggtgtggcatactgcccgcactgt
gacgggccgttgtttgccggtaaacatgttgccgtaatcggcgggggaaactccggcatt
gaagcggccattgaccttgctggtgtggtcaaacatgtaaccgtcattgaatttatgcct
gaattaaaggcggaccgtgtgctgctcgagcgcctttacagccttccgaatgtgacggtt
gtaaaaaatgcgcaaacgaaagaaattaccggcacggataaagtgaacggaatcacatat
attgaccgtgcaaccggggaagaacaccatattgaactcgagggcgtgtttgtccaaatc
ggccttgtcccgaataccgaatggcttggcgatacagtggaacggacaccgcggggtgaa
attgtggtggataagcgcggcgcgaccagtgttccgggcgtgtttgccgcaggagactgc
acagacagcgcttataagcaaatcattatttcgatggggtccggcgcgacagctgcgctc
gccgcttttgattacatcatccgggaaacgaaaacggatgaagctgtacacaattaa

DBGET integrated database retrieval system