KEGG   Bacillus coagulans 2-6: BCO26_1968Help
Entry
BCO26_1968        CDS       T01527                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00010  Glycolysis / Gluconeogenesis
bck00030  Pentose phosphate pathway
bck00051  Fructose and mannose metabolism
bck00052  Galactose metabolism
bck00680  Methane metabolism
bck01100  Metabolic pathways
bck01110  Biosynthesis of secondary metabolites
bck01120  Microbial metabolism in diverse environments
bck01130  Biosynthesis of antibiotics
bck01200  Carbon metabolism
bck01230  Biosynthesis of amino acids
bck03018  RNA degradation
Module
bck_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_1968
   00030 Pentose phosphate pathway
    BCO26_1968
   00051 Fructose and mannose metabolism
    BCO26_1968
   00052 Galactose metabolism
    BCO26_1968
  09102 Energy metabolism
   00680 Methane metabolism
    BCO26_1968
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BCO26_1968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bck01009]
    BCO26_1968
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bck03019]
    BCO26_1968
Enzymes [BR:bck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCO26_1968
Protein phosphatases and associated proteins [BR:bck01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BCO26_1968
Messenger RNA biogenesis [BR:bck03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BCO26_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 DAGK_cat NAD_kinase Host_attach
Motif
Other DBs
NCBI-ProteinID: AEH54027
UniProt: F7Z0K5
LinkDB All DBs
Position
complement(1998197..1999159)
Genome map
AA seq 320 aa AA seqDB search
MKRIGVLTSGGDAPGMNAAVRAIARKGIYHGLEVYGIHQGYNGLIQGNIQKLEAGSVGDI
LQRGGTVLQSARSEEFKTPEGQQKAIRQLKDHGIEALVVIGGDGSYQGAKKLTEQGFNCI
GVPGTIDNDIPGTDFTIGFDTALNTVLDAIDKIRDTASSHERTFIIEVMGRNAGDIALWS
GLAGGAESIIIPEEKFDLKDVVERLEQGRKRGKRHSIIIVAEGVMSGNEFAEQLKKTGVI
GDTRVSVLGHIQRGGSPTAFDRVLASRLGARAVELLLEGKGGRAVGIQNNQLVDHDILEI
LGKPHAVNKNMYKLSKELSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaattggagtattgacaagcggcggcgatgcaccggggatgaatgcggcggtc
cgcgcgattgcccgtaaagggatttatcacggcctggaagtttacggcattcaccaaggt
tataacggattgattcaaggaaacatccaaaagctcgaagcaggatctgttggcgatatt
ctccagcggggcggcacggttttgcagtcggcaagaagcgaagaattcaaaacgccggaa
gggcagcaaaaagcgatcaggcagctgaaagaccatggcattgaagcgctcgttgtgatc
ggcggcgacggttcctaccaaggggccaaaaaattgacggaacagggctttaactgcatt
ggtgtgccagggacaatcgataacgacatcccggggacggattttacaatcggttttgat
acggcattgaacacagtgcttgatgcgattgataaaattcgcgacaccgcttcttcccat
gaacgcacctttattattgaagtcatgggcagaaatgccggggatatcgcgctctggtcc
ggcctggccggcggagccgaatcgattattattccggaagaaaaatttgacttaaaagat
gtcgtggagcgtcttgaacaggggagaaaacgcggcaaacgccacagcatcatcattgtc
gcggaaggcgtgatgagcggcaacgagtttgctgaacaattgaaaaaaaccggtgtgatc
ggcgatacccgcgtttctgttctcggccatatccagcgcggcggttctccgacggcattt
gaccgcgtgcttgcaagccgcctcggcgcaagggctgttgaactgctgcttgaaggaaaa
gggggccgcgctgtcggcattcaaaataaccagctggttgaccacgatatccttgagatt
ctcggaaaaccgcacgccgttaataaaaacatgtacaagctgtcgaaagaattgtcgatc
taa

DBGET integrated database retrieval system