KEGG   Bacillus coagulans 2-6: BCO26_2562Help
Entry
BCO26_2562        CDS       T01527                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCO26_2562
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BCO26_2562
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BCO26_2562
    1.1.1.-  
     BCO26_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEH54620
UniProt: F7YZF8
LinkDB All DBs
Position
complement(2632419..2633468)
Genome map
AA seq 349 aa AA seqDB search
MKAAVWHGEKDIRVEDVELRPLKENEVKVKVAWAGICGSDLHEYQEGPVFIPVGEENEFT
GEKAPLTMGHEFAGVIEEVGSKVTKYKAGDRVVINPTITRGIKPDEFDRYDGYAFIGLHS
NGGFAAYANIPENNIYRVPDSLSLEEAALVEPSAVAVQAVKDSGLRFGDTVAIFGAGPIG
LLTIVAARAAGASRIVVADLSQPRLDLAKKAGATDIINSGEKDAVQTIRDLVPGGVDVSF
EVAGVAPTFKQALDATKARGIVDVISIFARPIEWNPMQLTNTGVSVTASIVYTKKTFQQT
INLIASGQLKPQDVVTSHIQLEEIVEKGFEALTKDKSQAKILVKLSGEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggcacggagaaaaagatattcgtgtagaagatgttgaattgcgc
ccgttaaaagagaatgaagtgaaagtaaaagtagcatgggccgggatttgcggcagtgac
ttgcatgaataccaggaagggccggtatttattcctgttggcgaagaaaatgaatttacc
ggtgaaaaagcgccgctcacgatggggcatgaatttgccggtgtgattgaagaagtcgga
tcaaaagttaccaagtataaagcaggcgacagggttgttattaacccgacgattacccgc
ggaatcaaaccggatgaattcgatcgttatgacggctacgcttttattggattacatagc
aatggcggatttgcggcatacgccaacattccagaaaataatatttaccgcgtgccggat
tccttgtctttggaggaagctgcattagttgagcctagcgcggttgctgtacaggctgtg
aaagatagtggtttaagatttggcgatacggttgcgatttttggtgcaggcccgatcgga
ttattgaccattgttgcagcacgtgcggcaggtgcaagccggattgtcgtggcggatttg
tcgcaacctcgtctggacctggcgaaaaaagcaggcgcgaccgacattattaactccggg
gaaaaagatgccgtccaaaccatccgtgatcttgttccgggcggcgtagatgtatccttt
gaagtggccggcgttgctccgactttcaaacaagcacttgatgcaacgaaagcacgcggg
attgtcgatgtcatttctatctttgcacgcccgatagaatggaacccgatgcagttaacg
aatacaggtgttagcgttacagcatcgattgtttacacgaagaaaacattccaacaaacg
attaacctgattgcatccggccaattgaaaccgcaagacgtcgttaccagccatatccaa
ttggaagaaatcgttgaaaaaggcttcgaagctttgacaaaagacaaatcccaggcgaaa
attttggttaaattgagcggggagaaataa

DBGET integrated database retrieval system