KEGG   Bacillus coagulans 2-6: BCO26_2751Help
Entry
BCO26_2751        CDS       T01527                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
bck00473  D-Alanine metabolism
bck01100  Metabolic pathways
bck01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bck00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCO26_2751
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BCO26_2751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bck01011]
    BCO26_2751
Enzymes [BR:bck01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BCO26_2751
Peptidoglycan biosynthesis and degradation proteins [BR:bck01011]
 Precursor biosynthesis
  Racemase
   BCO26_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEH54807
UniProt: F7YZQ1
LinkDB All DBs
Position
complement(2830949..2832100)
Genome map
AA seq 383 aa AA seqDB search
MAFYRDTWVEVDLDAISENVGNMRRLLPEHTQIIAVVKANAYGHGAEYVAKTALASGASA
LAVAFLDEALALRKKGITAPILVLGAARPEDAGIAAEENISLTVFQKDWLEEAGRYLTGR
KLSVHLKCDTGMGRIGVRTVQELKEVEKIVNQQSCFFFEGIFTHFATADEIDMTLYEKQY
SRFQDMVLNLENRPPYVHCANSAAALRFDQSPFNAVRFGIAMYGLSPSPAIKPVLPFPLK
EAFSLHTKVTHVKQIHAGDTVSYGATYQASGDEWIATLPIGYADGWIRRLSGQEVIIGGE
RAPIVGRICMDQCMVRIPRPVAVGTKATLIGKQGDLSVPVDEIAKKLDTINYEVTCSISS
RVPRVFRKNGNDAAGVSNPVLEG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctttttaccgggatacatgggtggaagtcgatttggatgccatttcggagaatgtc
ggaaatatgcgccgcctgttgccggagcatacgcaaatcattgcggttgtaaaagctaac
gcttacgggcacggcgcggaatatgtggcgaaaaccgcgcttgcatccggagcttcagcg
cttgcggttgcatttttggacgaggcgctcgcgttacgaaaaaaagggattaccgctccg
atacttgttttgggggcagcccgtccggaagatgccggaatcgctgctgaagaaaacatc
tccctgactgtttttcaaaaagactggctcgaggaagcaggccggtatttaaccgggcgg
aaactatccgtccatcttaaatgtgataccggaatgggccggattggcgtaagaaccgta
caggaattaaaagaagtggaaaaaatcgtgaaccaacaatcttgtttcttttttgaaggg
atttttacccactttgcgacagcggatgaaatcgatatgactttgtatgaaaagcaatac
agccggtttcaggatatggttttaaaccttgaaaaccgaccgccgtatgtgcactgcgca
aacagcgccgccgctttgagatttgaccagtctccgtttaatgctgtccgtttcggcatt
gcgatgtacgggctctccccatcgcccgccatcaagccggttttgccgtttccgttaaaa
gaggcgttctcccttcatacgaaggtgacgcatgtgaaacaaatccatgccggggacacg
gtgagttacggcgcaacctatcaggcttccggcgatgaatggatcgccacgcttccgatc
ggatatgcggatggctggatccgcaggctctcaggtcaggaagtgatcatcggcggggaa
agagcgcctattgtcggcaggatttgcatggatcagtgcatggtaaggatcccccgtccg
gttgctgtcgggacaaaagcaacgctgattggaaaacagggggatttgtccgttcctgtt
gatgaaattgccaaaaagctcgataccatcaactatgaggtgacctgttccatttcaagc
cgggtcccgcgcgttttccggaaaaacgggaacgatgccgcgggcgtgtcgaatccggtc
cttgaagggtga

DBGET integrated database retrieval system