KEGG   Bacillus clausii: ABC0046Help
Entry
ABC0046           CDS       T00228                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcl  Bacillus clausii
Pathway
bcl00010  Glycolysis / Gluconeogenesis
bcl00071  Fatty acid degradation
bcl00350  Tyrosine metabolism
bcl00625  Chloroalkane and chloroalkene degradation
bcl00626  Naphthalene degradation
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC0046 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    ABC0046 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABC0046 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABC0046 (adhA)
   00626 Naphthalene degradation
    ABC0046 (adhA)
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABC0046 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 Methyltransf_11 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAD62589
UniProt: Q5WLY6
LinkDB All DBs
Position
62619..63668
Genome map
AA seq 349 aa AA seqDB search
MSKTSERRMMKAAVVNQFNQQLEIKEVPVPTVEYGEVLVKIKACGVCHTDLHAAHGDWPV
KPKLPLIPGHEGVGIVEEIGEGVTSIKVGDRVGIPWLYSACGECEYCLTGRETLCPDQLN
AGYSVDGGYAEYCKAPANYIVKIPENLDFAEVSPIFCAGVTTYKALKVADAKAGDWVAIY
GIGGLGHVALQYAKAMGYNVVAVDIMEDKLELAKRLGADLTVNGLQVDPVQEIKEKVGGV
QAAISVAVTKKAFEQAYGSVKRGGTLVVVGLPNDELPIPIFDTVLNGVTVKGSIVGTRKD
LQESIEFAAQGKVRTNIETQPLDKINEVFERMENGKINGRVVLTIDETA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacaagcgaacgaagaatgatgaaagcggcggtcgttaatcagttcaatcaa
caattagagattaaggaagttccggtacctaccgtggagtatggagaggtgcttgtcaaa
attaaggcttgcggtgtttgtcatacagacttgcatgccgctcatggagattggccagta
aagccaaagcttcctcttattcctggtcatgagggagtaggtattgtagaggaaatagga
gaaggggtcacttcgataaaggtaggagatcgggtcggcattccgtggctttactctgca
tgtggagagtgtgagtattgtttaacaggccgtgagacgttatgccctgaccaattaaat
gcaggttattcagtggatgggggatatgcagagtattgtaaggcgcctgccaattatata
gtgaaaatacctgagaatcttgattttgctgaagtgtcccctattttttgcgcaggggtg
acgacttacaaagcattaaaagtagccgatgccaaagccggtgactgggttgccatttat
ggaatcggtggattgggtcacgttgctttgcagtacgcaaaagcaatgggctataacgtc
gtcgctgtcgatattatggaggacaaacttgaattagcaaaacgtcttggagctgattta
acagtcaatggacttcaggtagaccctgttcaagaaataaaagaaaaagtgggcggagtt
caagcagctattagcgtggcagtcacaaaaaaagcatttgagcaagcttacggatctgtc
aaaagaggagggacattagtcgttgtgggccttccaaacgatgaattgcccattccgatt
ttcgatacggtgctaaacggtgtaaccgtgaaaggctcaatcgtagggacgcgcaaagac
ttgcaagaatcgattgaatttgcagcacaagggaaagtgcgaaccaacatcgaaacacag
ccgctcgataaaattaacgaagtgtttgaaagaatggagaatggaaaaattaacggtcgt
gttgtgttaacaattgatgaaaccgcttaa

DBGET integrated database retrieval system