KEGG   Bacillus clausii: ABC0821Help
Entry
ABC0821           CDS       T00228                                 

Definition
(GenBank) restriction endonuclease R XbaI
Organism
bcl  Bacillus clausii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-ProteinID: BAD63360
UniProt: Q5WJU5
LinkDB All DBs
Position
892277..892915
Genome map
AA seq 212 aa AA seqDB search
MQVVENAIRTLAETYADRLNKQVLKRVKDMESDDKSHYLIYQVLKVTLEEGEMIDVYQNK
GRFLYKYAGSFLEEAAILCFEYKFGEDALKKVKIANTLGQRPKTFEIDCLVGDNAYEIKW
RDATTDGDHITKEHTRMQVIKDAGYMPNRIMFYYPNRTQAIRIQQTLETLYHGAGGHYYY
GDSAWKHIYKVTDVDLKGILMKIAGENLASKE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcgtagagaatgcaattagaacactagcggaaacatacgcagacagactaaac
aaacaagttttaaaacgagtgaaagatatggaaagtgatgataaatcacattacctaatt
tatcaagttttaaaagttacattagaagaaggggaaatgattgacgtatatcaaaataaa
ggacgtttcttatacaagtatgcgggttcatttttggaagaagcagccatactttgtttt
gaatataagtttggtgaagatgctttgaagaaggtgaaaatagctaacacactaggacaa
cgacctaaaacatttgaaatagattgtcttgtcggcgataatgcttatgagataaaatgg
agagacgctacaacagatggcgaccatataactaaagagcatacccgtatgcaagtaatt
aaagacgcgggttatatgccaaatcgaataatgttttattatccaaatagaacccaagct
attcgcattcaacaaacgttagaaaccttataccacggtgcggggggacattattattat
ggtgattctgcatggaaacacatatataaagttaccgatgttgacttaaaaggaattcta
atgaagatagccggggaaaatttagcaagtaaggagtaa

DBGET integrated database retrieval system