KEGG   Bacillus clausii: ABC1097Help
Entry
ABC1097           CDS       T00228                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bcl  Bacillus clausii
Pathway
bcl00970  Aminoacyl-tRNA biosynthesis
bcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABC1097 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bcl03029]
    ABC1097 (gatA)
Enzymes [BR:bcl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ABC1097 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ABC1097 (gatA)
Mitochondrial biogenesis [BR:bcl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ABC1097 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAD63635
UniProt: Q5WJ20
LinkDB All DBs
Position
1189638..1191089
Genome map
AA seq 483 aa AA seqDB search
MSLFDHSLTKLHELLAAKEINVSDLVDVSYKRIADVDSKVKAFLTLDEERARDLAKKLDE
VDASEKGVLFGMPIGIKDNIVTKGLRTTCSSKILENFDPIYDATVVTKLRGAETVTIGKI
NMDEFAMGSSNENSAFQVTTNPWNTDYVPGGSSGGSAAAVAAGEVPFALGSDTGGSIRQP
AAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAYLLEAIAGHCPADSTSAD
LPVPPYRESLTGEIKGLRIGVPSEYIGDGVSEEMRKAVFDALNVLEKEGAVWEEVSLPYS
KYALAAYYVIASSEASANLARFDGVRYGYRTDNADNLLDMYKNTRAEGFGDEVKRRIMLG
TFALSSGYYDAYYKKAQQVRTLIKKDFDDVFTNYDVIIGPTTPTPAFKIGAKTDDPLTMY
ANDILTIPVNLAGVPALSLPCGFKDGLPLGLQIIGKHFDEATIYRVADVYEKATNFSKEK
PSL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatttgatcattcgttaacaaaactgcatgagttgcttgctgcaaaagaaatc
aacgtctctgaccttgtcgatgtctcttacaaacgcatcgctgacgttgattcaaaagta
aaggcgtttttaacgcttgacgaagaacgggcgcgcgacctcgccaagaagcttgacgaa
gtagacgcgagtgaaaaaggcgtgttgtttggcatgccgattggcattaaagacaatatt
gtcacgaaaggcttgcggacaacgtgctcaagcaaaattttagaaaacttcgatcccatt
tatgacgcaacggttgtaacgaagcttcgtggagcagaaacggtcacaataggaaaaatc
aacatggacgagtttgcaatgggctcttcgaatgaaaactcggcatttcaagtaacgaca
aacccgtggaacaccgactatgtgccaggcggttcaagtggtggttctgctgcagcagta
gcagcaggggaagtcccgtttgcgttaggatctgatacaggcggctcgattcgccaacca
gctgcttattgcggcgttgtcggcttaaaacctacatatggacgggtgtcccgttatggc
cttgttgcttttgcctcttcccttgatcaaattgggccgattacgcgtacggtcgaggat
aatgcctatttgcttgaggcgattgctggccactgcccagctgattcgacatctgctgac
ttgccggttccgccatacagagagtcacttacaggcgaaataaaagggcttcgcattggc
gtgccgtctgagtatattggcgatggcgtatcagaagaaatgcgcaaagccgtgttcgat
gcgctgaacgtgttggaaaaagaaggcgccgtttgggaagaagtttccctgccatactcg
aaatacgcgctagcagcttattatgtcattgcgtcttccgaagcgtctgctaacttagcc
cgctttgatggcgttcgttatggctaccgcactgacaatgccgacaacttgcttgatatg
tacaagaatacacgggctgaaggtttcggtgatgaagtgaaacggcggatcatgctcggg
acgtttgcccttagctcaggttattatgacgcctactataaaaaagcccagcaagtccgc
acattgattaaaaaagactttgatgatgtctttactaattatgacgtaattattggccca
acaacgccgacaccagcgtttaaaattggcgccaaaaccgatgacccattaacgatgtac
gccaatgatattttaacgataccagtcaaccttgctggtgtgccagcgctttcgcttccg
tgcggtttcaaagacggcttgccgctcggcttgcaaatcattggcaagcactttgacgaa
gcaacgatttaccgtgttgccgatgtctatgaaaaagcaacaaacttctctaaagagaaa
ccttcattgtaa

DBGET integrated database retrieval system