KEGG   Bacillus clausii: ABC1715Help
Entry
ABC1715           CDS       T00228                                 

Gene name
sodA
Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bcl  Bacillus clausii
Brite
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ABC1715 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAD64250
UniProt: Q5WHA5
LinkDB All DBs
Position
1842586..1843194
Genome map
AA seq 202 aa AA seqDB search
MAYKLPELPYAANALEPHIDEATMNIHHGKHHNTYVTNLNAALEGHAALAEKSIEDLVAN
LDAVPENIRTAVRNNGGGHANHTFFWQILSPNGGGEPTGALAEDIKSTFGSVEEFKNKFA
DAAKGRFGSGWAWLVVNNGNLEITSTPNQDTPLSEGKTPILGLDVWEHAYYLNYQNRRPD
YIAAFWNVVNWDEVSKRYEAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaactaccagaattgccttatgctgcaaatgcacttgagccgcatattgat
gaggcgacaatgaacattcaccacggcaaacaccacaatacgtatgtaacaaacttaaat
gctgcattggaagggcatgcagcccttgcagagaagagcattgaagacttggtggcaaac
ttggatgctgttccagaaaacattcgtacagcggttcgcaacaatggcggaggccatgca
aaccacacatttttttggcaaattttaagtccaaatggtggcggcgagccgactggtgct
ctagcagaagatattaaatcaactttcggcagcgttgaagaattcaaaaacaaatttgca
gacgcagcaaaagggcgctttggttcaggatgggcttggctagttgtcaacaacggcaat
ttagaaattacaagcacgcctaaccaagatacacctttatctgaagggaaaacgcctatc
ctcggacttgacgtctgggaacacgcttactacttgaactaccaaaaccgtcgcccagac
tacattgcagctttctggaatgtcgtcaattgggacgaggttagcaaacgttacgaagca
gcaaaataa

DBGET integrated database retrieval system