KEGG   Bacillus clausii: ABC2907Help
Entry
ABC2907           CDS       T00228                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bcl  Bacillus clausii
Pathway
bcl00473  D-Alanine metabolism
bcl00550  Peptidoglycan biosynthesis
bcl01100  Metabolic pathways
bcl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABC2907 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABC2907 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ABC2907 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcl01011]
    ABC2907 (ddlA)
Enzymes [BR:bcl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ABC2907 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:bcl01011]
 Precursor biosynthesis
  Amino acid ligase
   ABC2907 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp_3 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: BAD65441
UniProt: Q5WDW9
LinkDB All DBs
Position
complement(3033526..3034632)
Genome map
AA seq 368 aa AA seqDB search
MAKKRVGIIFGGKSAEHEVSLQSAKNIVEAIDKDRFDVTLIGIDKQGQWHINEASNFLLN
ADNPALIELNKSNQGVALIPGKEDRQLVGTANQSVLDQLDVVFPIVHGTLGEDGSLQGMF
RLANLPFVGSNVLGSAVSMDKDIAKRLLQGAGLHVASGLTFTRAAKETIDFESIADQLGL
PLFIKPANQGSSVGVNKATTEAEFTAAIEEAFSYDHKVLIEAAIKGREIECAVLGNDYPK
ASTCGEILPQDGFYSYDAKYIDEDGAKLAIPADLPEDVNRRIQDIAIQAYKTLNCEGLAR
VDVFLTETGEVIINEVNTLPGFTKISMYPKLWEASGVSYQDLITTLIELAIERHERDKQL
KSSVFDRN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagaaacgagtaggcattatttttggaggaaaatctgctgagcatgaagtttca
ctgcaatcagcaaaaaatattgttgaggcgattgataaagatcgttttgacgtgacattg
attggcattgacaaacaaggccaatggcatataaatgaagcgtctaattttttacttaac
gcagataatccagctttaattgagctaaataaatcgaatcaaggcgtagcccttattcct
gggaaggaagacaggcaactggtgggcacggcaaaccagtcggttcttgaccagcttgat
gtcgtgttcccaattgtacatggtacccttggagaagatggatcgttgcaagggatgttt
cgtcttgccaatttgccatttgtcgggtcaaatgtgcttggctcggcagtgagcatggat
aaagacattgcgaagcggctgcttcaaggggccggcctccacgttgcaagtgggttgaca
tttacccgtgctgctaaggaaacgattgattttgagagcattgctgatcaattagggctg
cccctatttataaagcctgccaaccaaggctcttctgttggtgtcaacaaagcaacaact
gaagctgaatttacggctgctattgaagaagcattttcgtatgaccataaagtgcttatt
gaagcagccattaaagggcgcgaaatcgaatgtgccgttctcggcaatgactacccgaaa
gcaagcacttgcggggaaattttgccacaagatgggttttattcgtatgatgcgaagtat
attgatgaagacggcgccaaattggcgatccctgcagatttgccggaagacgtcaatcgc
cgtatccaagacattgccattcaagcttacaaaacattgaattgtgaaggcttggctcgt
gttgatgtgtttttaactgaaacaggcgaagtgatcattaatgaagtgaatacattgcct
ggctttacgaaaatcagcatgtacccgaaattatgggaagcgagcggtgtgtcttatcaa
gacttgattacaacgttaattgagcttgccattgagcgccatgaacgggacaaacagctg
aaaagctcggtttttgaccgcaattga

DBGET integrated database retrieval system