KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0298Help
Entry
Bcenmc03_0298     CDS       T00669                                 

Definition
(GenBank) Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)), Phosphate acetyltransferase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00620  Pyruvate metabolism
bcm00710  Carbon fixation in photosynthetic organisms
bcm01100  Metabolic pathways
bcm01120  Microbial metabolism in diverse environments
bcm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcenmc03_0298
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcenmc03_0298
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Bcenmc03_0298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ACA89478
UniProt: B1JTN8
LinkDB All DBs
Position
1:328047..330317
Genome map
AA seq 756 aa AA seqDB search
MDEQLKQAALAYHLNPKPGKISVTPTKPLSNQLDLSLAYSPGVAAACEAIHADPLDAQKY
TSRGNLVGVITNGTAVLGLGNIGPLAAKPVMEGKGCLFKKFAGIDVFDIELSESDPDKLV
EAIAMLEPTLGGINLEDIKAPECFYIEQKLRERMKIPVFHDDQHGTAIIASAAILNGLKV
VGKKLSEVKLVCSGAGAAAIACLDLLVNLGLTKSNILVADSKGVIYEGRGNLDPSKQRYA
ANTDARTLADAIVGADVFLGCSSAGVLKQDMVKTMGERPLILALANPEPEIRPEDAKAVR
PDAIVATGRSDYPNQVNNVLCFPFIFRGALDVGATTITEEMKLACVRAIAELAEETDQSE
EVAKAYEGHSLEFGPDYLIPKPFDPRLIIKIAPAVAQAAMDSGVATRPIQDMDAYREQLG
ATVYRTGMVMRPVFAAAKQKEARIVFAEGEDERVLRAAQFVLLEKIAKPIIVGRPSVVDM
RLQKIGSKLKAGVDFEIVDPEDDARYHRYWQAYQEIGARDGVTPEVAKAAMRKFNTLIGA
MLVHLGDADGMICGMIDTFHSHLKFIEQVLGRAKGAEHFAAMNLLMLPGRNLFVCDTYVN
ELPSADQLADMTIQAAAEIERFGIAPKAALLSNSNFGSAPSASSRRMAEARKLIVERAPN
LEVDGEMHGDAALSELIRKQAFPGTTLSGEANLLIMPNVEAANIAYNLLKMVGGEGVTVG
PFLLGAAKPVHILTPAATVRRIINMTAVAAANVNTK
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaactgaagcaggccgctctcgcttatcacctgaacccgaaacccggcaag
atttcggtcaccccgaccaagccgctgtcgaaccagctcgatctgtcgctcgcgtattcg
cccggcgtcgccgctgcgtgcgaggcgatccacgccgatccgctcgacgcgcagaagtac
acgtcgcgcggcaacctcgtcggcgtcatcacgaacggcaccgccgtgctcggcctcggc
aacatcggcccgctggccgcgaagccggtgatggaaggcaagggctgcctcttcaagaaa
ttcgcgggcatcgacgtgttcgacatcgaactgtcggagtccgaccccgacaagctcgtc
gaggcgatcgcgatgctcgagccgacgctcggcggcatcaacctcgaggacatcaaggcg
ccggaatgcttctacatcgagcagaagctgcgcgagcgcatgaagatcccggtcttccac
gacgaccagcacggcaccgcgatcatcgcgtcggccgcgatcctgaacggcctgaaggtc
gtcggcaagaagctgtcggaagtgaagctcgtgtgttcgggcgcgggcgcggcggcgatc
gcgtgcctggacctgctggtgaacctcggcctcacgaagtcgaacatcctcgtcgccgat
tcgaagggcgtgatctacgaagggcgcggcaacctcgatccgtcgaagcagcgctatgcg
gcgaacaccgacgcgcgcacgctcgccgatgcgatcgtcggcgcggacgtgttcctcggc
tgctcgagcgcgggcgtgctgaagcaggacatggtcaagacgatgggcgagcgcccgctg
atcctggcgctcgcgaacccggaaccggaaatccgcccggaagacgcgaaggccgtgcgc
ccggacgcgatcgtcgcgaccggccgttcggactacccgaaccaggtcaacaacgtgctg
tgcttcccgttcatcttccgcggcgcgctcgacgtcggcgcgacgacgatcacggaagag
atgaagctcgcgtgcgtgcgcgcgatcgccgagctggccgaggaaaccgaccagagcgag
gaagtcgcgaaggcgtatgaaggccattcgctcgaattcgggccggactacctgattccg
aagccgttcgatccgcgcctgatcatcaagatcgcgccggccgtggcgcaagccgcgatg
gattcgggcgtcgccacgcgcccgatccaggacatggacgcgtaccgcgagcagctcggc
gcgaccgtctaccgcaccggcatggtgatgcgcccggtgttcgcggccgcgaagcagaag
gaggcccgcatcgtgttcgccgaaggcgaggacgagcgcgtgctgcgcgccgcgcagttc
gtgctgctggaaaagatcgccaagccgatcatcgtcggccgtccgtcggtcgtcgacatg
cgcttgcaaaagatcggctcgaagctgaaggccggcgtcgatttcgaaatcgtcgatccg
gaagacgatgcgcgctaccaccgctactggcaggcgtatcaggagatcggcgcgcgcgac
ggcgtgacgccggaagtcgcgaaggccgcgatgcgcaagttcaacacgctgatcggcgcg
atgctcgtccatctgggcgatgcggacgggatgatctgcgggatgatcgacacgttccac
agccacctgaagttcatcgagcaggtgctgggccgcgcgaagggcgccgagcacttcgcc
gcgatgaacctgctgatgctgccgggccgcaacctgttcgtgtgcgacacgtacgtgaac
gagctgccgagcgccgaccagctcgccgacatgacgatccaggccgcggccgagatcgag
cgcttcggcatcgcgccgaaggccgcgctgctgtcgaactcgaacttcggcagcgcgccg
tcggcgtcgtcgcgccggatggccgaggcccgcaagctgatcgtcgaacgtgcgccgaac
ctcgaagtcgacggcgaaatgcacggcgacgcggcgctgtcggaactgatccgcaagcag
gcgttcccgggcacgacgctgtcgggcgaagcgaacctgctgatcatgccgaacgtcgaa
gcggcgaacatcgcgtacaacctgctgaagatggtcggcggcgaaggcgtgacggtcggc
ccgttcctgctcggcgccgccaagccggtccacatcctgacgccggccgcgaccgtgcgc
cggatcatcaacatgacggccgttgccgccgcgaacgtgaatacgaagtaa

DBGET integrated database retrieval system