KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1485Help
Entry
Bcenmc03_1485     CDS       T00669                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00020  Citrate cycle (TCA cycle)
bcm00310  Lysine degradation
bcm00380  Tryptophan metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
Module
bcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcenmc03_1485
  09105 Amino acid metabolism
   00310 Lysine degradation
    Bcenmc03_1485
   00380 Tryptophan metabolism
    Bcenmc03_1485
Enzymes [BR:bcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcenmc03_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACA90660
UniProt: B1K0M9
LinkDB All DBs
Position
1:1647239..1648519
Genome map
AA seq 426 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAAPAAQPAAATASSSA
AASPAAAKLLAEKGLSTGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALP
EVKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNK
YKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGL
VVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIIN
PPQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPA
RLLLDL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagttgtcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtcctcgaagtgccggcaccggcagcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtggccgaccagatcatcgcgacgatcgataccgaa
gcgaaggcaggtgctgccgaagcagcggcaggcgccgccgaagtcaagccggcagccgcg
cctgcagcagcagccgcaccggccgctcagccggcagccgcaacggcatcgagctcggcc
gccgcatcgcctgccgcagcgaagctgctggccgagaagggcctgtcgacgggcgacgtc
gcaggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggcagcaggcagcgca
ccgaaggctgctccggccgccgcaccggcgaagaccgccgccgcgaagccggcgctgccg
gaagtgaaggtgccggcgtcggcagcgacctggctgaacgaccgtccggaacagcgcgtg
ccgatgtcgcgcctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaac
gcgatcctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgcaacaag
tacaaggacaagttcgagaaggaacacggcgtgaagctcggcttcatgtcgttctttgtg
aaggcggccgtccatgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggtaac
gacatcgtctaccacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctg
gtcgtgccgatcctgcgcaacgcggatcaactgagcctcgccgagatcgagaagaagatc
gccgaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggt
acgttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaac
ccgccgcaatcggccatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaac
ggccagatcgtgatccgcccgatcaactacctcgcgctgtcgtacgaccaccgcatcatc
gacggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggca
cgcctgctgctcgacctgtaa

DBGET integrated database retrieval system