KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1525Help
Entry
Bcenmc03_1525     CDS       T00669                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00030  Pentose phosphate pathway
bcm00710  Carbon fixation in photosynthetic organisms
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
bcm01230  Biosynthesis of amino acids
Module
bcm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bcm_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcenmc03_1525
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bcenmc03_1525
Enzymes [BR:bcm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Bcenmc03_1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A Sugar-bind DeoRC
Motif
Other DBs
NCBI-ProteinID: ACA90700
UniProt: B1K0R9
LinkDB All DBs
Position
1:1694300..1694995
Genome map
AA seq 231 aa AA seqDB search
MTQDELKRLVGQAAADYVIQNVPEGAVIGVGTGSTANCFIDALAAVKSRYRGAVSSSIAT
TERLKSHGIKVFDLNEIESLQVYVDGADEIDAGGAMIKGGGGALTREKIVASVADTFVCI
ADASKRVPVLGAFPLPIEVVPMARTAIGRRVTALGGVPVLRVTKDGAPYITDNGNEIIDV
KGLQIADPRGFEAQVNAWPGVVTVGLFAERGANLCLLGTENGVETIVYPAG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagacgaactcaaacgcctcgtcggccaggccgccgccgattacgtgatccag
aacgtgcccgaaggcgccgtgatcggtgtcggcaccggctcgaccgccaactgcttcatc
gacgcgctcgccgccgtcaaatcgcgctatcgcggcgccgtgtcgagctcgattgcgacg
accgaacgcctgaaatcgcacggcatcaaggtgttcgacctgaacgagatcgagtcgctg
caggtgtacgtcgacggcgccgacgagatcgacgccggcggcgcgatgatcaagggcggc
ggcggcgcgctgacgcgcgagaagatcgtcgcatcggtggccgacacgttcgtctgcatc
gcggacgccagcaagcgcgtgccggtgctcggcgcgttcccgctgccgatcgaggtcgtg
ccgatggcgcgcacggcgatcggccggcgcgtgaccgcgctcggcggcgtgcccgtgctg
cgcgtgacgaaggacggcgcaccctacatcaccgacaacggcaacgagatcatcgacgtg
aagggcctgcagatcgccgatccgcgcggtttcgaagcgcaggtgaacgcatggccgggc
gtcgtgacggtcggtctgttcgccgaacgcggcgcgaatctgtgcttgcttggcacggaa
aacggcgttgaaacgatcgtttatccggctggctaa

DBGET integrated database retrieval system