KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2028Help
Entry
Bcenmc03_2028     CDS       T00669                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00061  Fatty acid biosynthesis
bcm00780  Biotin metabolism
bcm01100  Metabolic pathways
bcm01212  Fatty acid metabolism
Module
bcm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bcenmc03_2028
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Bcenmc03_2028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcm01004]
    Bcenmc03_2028
Enzymes [BR:bcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Bcenmc03_2028
Lipid biosynthesis proteins [BR:bcm01004]
 Fatty acid synthase
  Component type
   Bcenmc03_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ACA91189
UniProt: B1JUD9
LinkDB All DBs
Position
1:complement(2250740..2251207)
Genome map
AA seq 155 aa AA seqDB search
MSTEKINLDIHKILTLLPHRYPILLVDRVLELEPHKGIKALKNVSINEPFFQGHFPKRPV
MPGVLILEALAQAAALLTFAEEQPKDPENTLYYFVGIDGARFKRVVEPGDQLILNVTFER
YIRGIWKFKAVAEVDGKVAAEAELMCTVKTADAAP
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaaaaatcaatctcgacatccacaagatcctcacgctgctgccgcatcgc
tacccgattctgctcgtcgatcgcgtgctcgaactcgagccgcacaaagggatcaaagcg
ctgaagaacgtgtcgatcaacgagccgttcttccaggggcatttcccgaagcggccggtg
atgccgggtgtgctgatcctcgaggcgctcgcccaggccgcggcgctgctgacgttcgcg
gaagagcagccgaaggatccggagaacacgctgtattacttcgtcgggatcgacggcgcg
cgtttcaagcgcgtggtcgaaccgggcgaccagctgatcctgaacgtgacgttcgagcgc
tatatccgcggcatctggaagttcaaggcggtggcggaagtggacggcaaggtggcggcg
gaagccgaactgatgtgcacggtcaagacggccgacgcggcgccctga

DBGET integrated database retrieval system