KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2154Help
Entry
Bcenmc03_2154     CDS       T00669                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00010  Glycolysis / Gluconeogenesis
bcm00020  Citrate cycle (TCA cycle)
bcm00620  Pyruvate metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
Module
bcm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_2154
   00020 Citrate cycle (TCA cycle)
    Bcenmc03_2154
   00620 Pyruvate metabolism
    Bcenmc03_2154
Enzymes [BR:bcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcenmc03_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N HlyD_D23 NQRA DEC-1_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: ACA91315
UniProt: B1JV15
LinkDB All DBs
Position
1:complement(2394934..2396583)
Genome map
AA seq 549 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEIGVKVGDTVEPEQSLVTLESDKATMDVPSPVGGVVKEI
KVKVGDSVSEGSLIILLEGGAGAQANGAAAPAAAPAPAAAPAPAPAAPAAAPAASGGTLE
VKVPDIGDYKDVPVIEIGVKVGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGD
SVSEGTLIVLLEAAGAPAAAPQASAPAPAAAAPAPAAAPAPAPAKAAPAPAAAAPAAAPS
GEYRASHASPSVRKFARELGVDVARVQGSGPKGRITKEDVTGFVKGVMTGQRAAPAAAAA
PAGGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITEL
EALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYFHVGFAAD
TPNGLVVPVIRDADKKGLVDIAKEMSDLSKAAREGKLKPDQMQGGCFSISSLGGIGGTNF
TPIINAPEVAILGLSRGQMKPVWDGKQFVPRLMLPLSLSYDHRVIDGAEAARFNAYLGAL
LGDFRRIIL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtgaaggtgccggatatcggcgattacaaggacgtgccggtc
atcgagatcggcgtgaaggtgggcgatacggtcgagcccgagcagtcgctcgtcacgctc
gagtcggacaaggcgacgatggacgtgccgagcccggtcggcggcgtcgtgaaggaaatc
aaggtcaaggtcggcgattccgtgtcggaaggctcgctgatcatcctgctcgaaggcggc
gcaggcgcccaggcgaacggcgcggccgcgccggccgcggctccggctccggcagcagca
ccggcaccggcacccgcagcccccgctgccgcaccggcagcgtccggcggcacgctggaa
gtgaaggtgcccgacatcggcgactacaaggacgtcccggtgatcgagatcggtgtgaaa
gtcggcgacacggtcgagaaggagcagtcgctcgtcacgctcgagtcggacaaggcgacg
atggacgtgccgagcccggccgccggtgtcgtgaaggacatcaaggtcaaggtgggcgat
tcggtgtcggaaggcacgctgatcgtgctgctcgaagccgccggcgcaccggctgccgca
ccgcaggccagcgcaccggctccggccgctgccgcaccggcgcctgctgctgcaccggca
cccgcgcctgcgaaggctgcgccggcaccggctgctgctgccccggccgccgcgccgtcg
ggcgaataccgcgccagccacgcatcgccgtcggtccgcaagttcgcacgcgaactcggc
gtcgacgtcgcgcgtgtgcagggttcgggtccgaagggccgcattacgaaggaagacgtc
acgggcttcgtgaagggcgtgatgaccggccagcgcgcggcaccggccgcggcagccgca
ccggcaggcggcggcgagttgaacctgctgccgtggccgaaggtcgatttctcgaagttc
ggcccgttcgaggcgaagccgctgtctcgcatcaagaagatctcgggcgcgaacctgcat
cgcaactgggtgatgatcccgcacgtcacgaacaacgacgaagcggacatcaccgagctc
gaagcgctgcgcgtccagctgaacaaggagcacgaaaaggcgggcgtgaagttcacgatg
ctcgcgttcgtgatcaaggcggtcgtcgccgcgctgaagaaattcccgaccttcaacgcg
agcctcgacggcgacaacctcgtgttcaagcagtacttccacgtcggtttcgcggccgat
acgccgaacggcctcgtcgtgccggtgatccgcgatgcggacaagaagggcctcgtcgac
atcgcgaaggaaatgagcgacctgtcgaaggccgcgcgcgaaggcaagctgaagccggat
cagatgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcgggacgaacttc
acgccgatcatcaacgcaccggaagtggcgatcctcgggttgtcgcgcggccagatgaag
ccggtgtgggacggcaagcagttcgtgccgcggctcatgctgccgctgtcgctgtcgtat
gaccatcgcgtcatcgatggcgcggaagccgcgcggttcaatgcgtatctcggagcgttg
ctcggggatttccggcgcatcattctttga

DBGET integrated database retrieval system