KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2549Help
Entry
Bcenmc03_2549     CDS       T00669                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00020  Citrate cycle (TCA cycle)
bcm00480  Glutathione metabolism
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01200  Carbon metabolism
bcm01210  2-Oxocarboxylic acid metabolism
bcm01230  Biosynthesis of amino acids
Module
bcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcenmc03_2549
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcenmc03_2549
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Bcenmc03_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACA91710
UniProt: B1JXD5
LinkDB All DBs
Position
1:complement(2844677..2845933)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggagggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtcgtcgatgcggcggtcgcgcatgcgtacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgaccaaggtgtac
ggtccggacgtgtggctgccggacgaaacgctgcaggtcctgaaggaatacgtggtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggagctcgatctgtacgtgtgcctgcgcccggtccagtatttcaagggcgtgccg
tcgccggtgcgcgagccgcagaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggctgcgggctccgagcaggcgaagaaggtgatcaaattc
ctgcaggacgagatgggcgtgaagaagatccgtttcccggaaacttccgggatcggcgtc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggaattcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcaacgagatcgtgatcaag
gattcgatcgccgatgccttcctccagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctggccgcgcaggtcggc
ggcatcgggatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcagccgacacgatcatcgcc
gcgatggagaagtcgattctgcagaagcgcgtcacgtacgatttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctccggcttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system