KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_2964Help
Entry
Bcenmc03_2964     CDS       T00669                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcenmc03_2964
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcm02000]
    Bcenmc03_2964
Enzymes [BR:bcm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcenmc03_2964
Transporters [BR:bcm02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcenmc03_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACA92122
UniProt: B1JZR1
LinkDB All DBs
Position
1:3302149..3302763
Genome map
AA seq 204 aa AA seqDB search
MKLYYWPKTRAFRALWMLEEIGGVYELVPIDLRSHEQGSDAFVQVNPMAKLPALDDGSAP
FAESGAVLLYLADRCPDAGLGVAPDDPLRGRFLQWMFFTPTCLEPAMAEKFTGASGNPVA
FGWGNITRVQRALAQALAHSRWLVGERFTAADLLLASTLKIAFDAHLLPHEGVLGDYVAR
AEDRDAFRRAVAIEQREAARLLHA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactggccgaagacccgggcattccgggcgctgtggatgctcgaggaa
atcggcggggtgtacgaactcgtgccaatcgacctgcgctcgcacgaacagggcagcgac
gcgttcgtgcaggtcaacccgatggcgaagctgcccgcgctcgacgacggcagcgccccg
ttcgccgaatcgggcgccgtgctgctctatcttgccgaccgttgcccggacgccgggctc
ggcgtcgcgcccgacgatccgctgcgcggccgcttcctccagtggatgttcttcacgccg
acctgcctcgaaccggcgatggccgagaaattcaccggcgcgtcgggcaacccggtcgcg
ttcggctggggcaatatcacgcgcgtgcagcgcgccctcgcgcaagcgctcgcccacagc
cgctggctcgtcggcgaacgcttcaccgcggccgacctgctgctcgccagcacgctgaag
atcgcgttcgatgcgcatctgctgccgcacgaaggcgtgctcggcgactacgtcgcacgc
gccgaggaccgcgacgcgttccgccgcgcggtcgcgatcgaacagcgcgaagcggcgcgt
ctgctgcacgcatga

DBGET integrated database retrieval system