KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3124Help
Entry
Bcenmc03_3124     CDS       T00669                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00970  Aminoacyl-tRNA biosynthesis
bcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bcenmc03_3124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bcm03029]
    Bcenmc03_3124
Enzymes [BR:bcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Bcenmc03_3124
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Bcenmc03_3124
Mitochondrial biogenesis [BR:bcm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Bcenmc03_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACA92282
UniProt: B1K0H7
LinkDB All DBs
Position
1:complement(3466053..3467543)
Genome map
AA seq 496 aa AA seqDB search
MHAKSLTELRAALAAKECSAVELAQHYLKRIDAARDLNAFVHVDADLTLAQAKAADAELA
RGAGGALTGLPIAHKDVFVTRGWRSTAGSKMLANYESPFDATVVARLQAAGMVTLGKTNM
DEFAMGSSNENSAFGAVKNPWDTNAVPGGSSGGSSAAVAARLAPAATGTDTGGSIRQPAS
FAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMAQSASDCALLLNAMAGFDERDSTSLERD
DEDFTRHLGQPWAAGNDAGKPLAGLRIGLPNEYFGAGLADDVRATIDAALKQYEALGATL
VPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAQYGDLLDMYKKSRAEGFGPE
VKRRILVGTYVLSHGYYDAYYLQAQKIRRIIANDFQEAFKSCDVIMGPASPTVAWDLGAK
GDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAKRPVGLQIIGNYFNEARMLQVAD
AFQRATDWHKQVPAGV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaaaagcctgaccgaactgcgcgccgcgctcgccgccaaggaatgctcggcc
gtcgagctcgcgcagcactatctgaaacggatcgacgccgcgcgcgacctgaacgcgttc
gtccacgtcgacgccgacctcaccctcgcgcaggcgaaagccgccgacgccgaactcgcg
cgcggcgcgggcggcgcgctcaccggcctgccgatcgcgcacaaggacgtgttcgtcacg
cgcggctggcgctcgaccgccggctcgaaaatgctcgcgaactacgagagcccgttcgac
gcgaccgtcgtcgcccgcctgcaggcggccggcatggtcacgctcggcaagaccaacatg
gacgagttcgcgatgggctcgtcgaacgagaactcggcgttcggcgcggtgaagaacccg
tgggacacgaacgcagtgccgggcggcagctcgggcggcagctcggccgccgtcgccgcg
cgcctcgcgccggccgcgaccggcaccgacaccggcggctcgatccgccagcccgcgtcg
ttcgcgggcgtgacgggcatcaagccgacctacggccgcgtgtcgcgctacgggatgatc
gcgttcgcgtcgtcgctcgaccagggcggcccgatggcgcagagcgcgtccgactgcgcg
ctgctgctgaacgcgatggccggcttcgacgagcgcgactcgacgagcctcgagcgcgac
gacgaagacttcacgcgccacctcggccaaccgtgggccgccggcaacgacgcgggcaag
ccgctcgcgggcctgcgcatcggcttgccgaacgagtatttcggcgccggcctcgccgac
gacgtgcgcgcgacgatcgacgcggcgctcaagcaatacgaggcgctcggtgcgacgctc
gtgccggtgtcgctgccgaagacggaactgtcgatccccgtgtactacgtgatcgcgcca
gcggaagcgtcgtcgaacctgtcgcgtttcgacggcgtgcgcttcggccaccgcgccgcg
cagtacggcgatctgctcgacatgtacaagaagtcgcgcgccgaaggcttcgggcctgaa
gtgaagcgccggatcctggtcggcacctacgtgctgtcgcacggctactacgacgcgtac
tacctgcaggcgcagaagatccgccgcatcatcgcgaacgatttccaggaagcgttcaag
tcctgcgacgtgatcatgggcccggcgtcgccgacggtcgcatgggatctcggcgcgaag
ggcgacgatccggtgcagatgtatctcgcggatatctacacgctgtcggtgagcctcgcg
ggcctgcccggcatgagcgtgccgtgcggcttcggcgcgggcgcgaacgcgaagcgcccg
gtcggcctgcagatcatcggcaactatttcaacgaagcccggatgctccaggtcgccgac
gcgttccagcgcgcgaccgactggcacaagcaagtaccggcaggggtgtaa

DBGET integrated database retrieval system