KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3273Help
Entry
Bcenmc03_3273     CDS       T00669                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bcenmc03_3273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcm02000]
    Bcenmc03_3273
Transporters [BR:bcm02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    Bcenmc03_3273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: ACA92429
UniProt: B1K8T2
LinkDB All DBs
Position
2:102048..103148
Genome map
AA seq 366 aa AA seqDB search
MPFAPKHLAAALAIVLGTAAGSAAAQVPAGYPGNYQGVIDAAKKEGKLIVYSTTDTGLVR
PLIKDFESLYGVKVEYNDMNSTELYNRYISENAASSTSADVLWSSAMDLQVKLVNDGLMA
SYDSPESPNVPQWAQYQKQAYGTTFEPLAIVYNKRLIPENEVPTTRADLIKLLTTQADKF
KGKVTTYDIEKSGVGFNYLTQDAHVNEKVTWELVKAIGATGPKLQSSTGAMMERISSGEN
LIGYNIIGSYAYAKAKKDKSIGYVFPKDYTQVVSRLATVSKKAKNPNAAKLWVDYLLSKR
GQTLIANQANLYAIRADVTGETSAASLTKELGDSLKPIQIGTGLLVYLDQSKRLAFLKQW
QQAIKR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgcaccgaagcacctcgccgccgcgctggcgatcgttctgggcactgccgcc
ggcagcgccgccgcgcaggttccggccggctacccggggaactatcagggcgtgatcgac
gccgcgaagaaggaaggcaagctgatcgtctactcgacgaccgacacgggcctcgtgcgt
ccgctgatcaaggacttcgaaagcctgtacggcgtgaaggtcgagtacaacgacatgaac
agcaccgagctgtacaaccgctacatcagcgagaacgcggcgagcagcaccagtgccgac
gtgttgtggagttcggcgatggatctgcaggtcaagctcgtcaacgacggcctgatggca
tcctacgattcgcccgaaagcccgaacgtgccgcagtgggcgcagtaccagaagcaggcg
tacggcacgacgttcgagccgctcgcgatcgtctacaacaagcggctgatccccgagaac
gaagtgccgacgacgcgcgccgacctgatcaagctgctcaccacgcaggccgacaagttc
aagggcaaggtcacgacctacgacatcgagaaatcgggcgtcggcttcaactatctgacc
caggacgcgcacgtgaacgagaaagtcacgtgggaactcgtcaaggcgatcggcgcgacc
ggcccgaagctgcagtcgagcacgggcgcgatgatggagcgcatctcgtcgggcgagaac
ctgatcggctacaacatcatcggttcgtatgcctacgcaaaggcgaagaaggacaagtcg
atcggctacgtgtttccgaaggactacacgcaggtcgtgagccgtctcgccacggtgtcg
aagaaggcgaagaacccgaacgccgcgaagctgtgggtcgactacctgctgtccaagcgc
ggccagacgctgatcgcgaaccaggcgaacctgtacgcgatccgcgcggacgtgaccggc
gaaacgtcggccgcgagcctcacgaaggaactcggcgattcgctgaagccgatccagatc
ggcaccggcctgctggtctatctcgaccagtcgaagcgcctcgcgttcctgaagcaatgg
cagcaggcgatcaagcgctga

DBGET integrated database retrieval system