KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3398
Entry
Bcenmc03_3398     CDS       T00669                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00440  Phosphonate and phosphinate metabolism
bcm00998  Biosynthesis of various secondary metabolites - part 2
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcenmc03_3398
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    Bcenmc03_3398
Enzymes [BR:bcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bcenmc03_3398
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: ACA92552
UniProt: B1K1X3
LinkDB
Position
2:251661..253346
AA seq 561 aa
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTGNGGAQ
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaactttaccgaatcacgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgatctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaggccggcttcaagggtatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaagtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgcgggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatcccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgctggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatccgcgatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaggaccgcgtggcctcggtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaatgccgcgatcgtgctcgccgcgagccgtggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggttggcggctatcgc
gccgatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccacgcggaaacg
ggcgagctcgcgtcgctcgcatgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctcaccgagaccaatcagagcgtgcgtgacttcgcc
ctctgctcggcggccgacgaccgcggcctgttcggccagaaaacctacctgcaacgcgtg
tcgagcgacgtcgcggcaggcaccccgcacggccgctggatcggcctgctgaacgtgcgc
ggcgcgggcgtcgatcgcctgaaggcgatgctcgcgacgctgcaggcgcgtcctgatttc
gacacgctcgacattccgtcgctgctgaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggtcactggcgcggcgtcaacgatctggaagacttccgccgcgcg
ggcgacttcgcgcacggccagacgccgctgtcggaaccgggcaccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system