KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_3433Help
Entry
Bcenmc03_3433     CDS       T00669                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcm  Burkholderia cenocepacia MC0-3
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcenmc03_3433
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bcenmc03_3433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 DAO K_oxygenase Thi4 Glutaredoxin NAD_binding_8 FAD_oxidored FMO-like
Motif
Other DBs
NCBI-ProteinID: ACA92586
UniProt: B1K207
LinkDB All DBs
Position
2:296841..298442
Genome map
AA seq 533 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETFFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGAGERAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGETKRVDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDYLIRQDVAAPAATAQSQVEEAVAA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactcaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcctcgctcgacgacagcgcgaaatcgcaggaactgctggcgctgctg
aacgagattgcgtcgctgacggatcgcgtgaccgtaaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgagcccggcaagccggccggcatccgcttcgccggc
atcccaatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagattcgcgcactcgacggcgactacgca
ttcgaaacgtttttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacgtcgcaatcgacggcgcgctgtttcag
gatgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgcatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggcgccggc
gaacgcgcggcgaagtcgctcgaaaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggcgggcgcggctgccgcgatctactcggcacgcaagggcatcgcgacgggtgtc
gtggccgagcgcttcggcgggcaggtgctggacacgatggcgatcgagaacttcgtgtcg
gttcaggaaaccgaagggccgaagttcgcgaccgcactcgagcagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgacgcgctgattccgggcgacgtgcatcag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcgtcctcgcgaccggcgca
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggggtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgtgtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgacctcgccggcatcgtgaaggaagtcacgctgatc
gaatacggcgcgcaactgcgtgcggacgaagtgctgcaacgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcagacgaccgaactgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatctgcgttccggtgaaacgaagcgcgtcgacctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaaggcacggtcgaactg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgccgggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggg
gcgaaggcgtcgctcggcgcgttcgattacctgatccggcaggacgtggcggcgccggcg
gccactgcgcagtcgcaggtggaagaagcggtcgccgcctga

DBGET integrated database retrieval system